KEGG   Cronobacter sakazakii ES15: ES15_3485Help
Entry
ES15_3485         CDS       T02119                                 

Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    ES15_3485
   00500 Starch and sucrose metabolism
    ES15_3485
Enzymes [BR:csk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     ES15_3485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
3778241..3779650
Genome map
AA seq 469 aa AA seqDB search
MTTRTLLPAILQAVMKGQPVALGDRHYPRWHLAPVTGLMNDPNGFIHFQGRYHLFYQWSP
LGCAHQHKCWGHWSSADLTHWQHEPLALMPDEEYDRSGCYSGSAVNDNGRLTLCYTGNVK
FDDGTRTAWQCLAVQNADGGFDKLGPVMPLPGGYTGHVRDPKVWRHGEHWYMVLGAQDLE
LQGKVLLLRSDTLWNWENLGEIAGSTLGGLGEAGYMWECPDLFMLDGKAILITCPQGVAR
EEKRYLNTYPSAYLCGDLNYDTPEFRHGPLMELDAGFEFYAPQTTLADDGRRLLIGWMGV
PDGEEMLQPTVAQGWIHQMTCPRELSLRDGLLCQQPVRELAALRGEEQRLEGVAATLSPL
AAESLELMLEAQGEVTLDFADTLRLEWTRDGLRLARRSLACGEWMHRYWQGDVRRLHILC
DRSSVEIFINDGEGVMSSRYFPAANATLGFEGDAQLRLRYWSLRACMVE
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaccacccgcacgctgctgcctgccattttacaggctgtgatgaaaggccagccggtc
gcgcttggcgatcgccactatccgcgctggcacctggccccggtgacgggcctgatgaac
gacccaaacggttttatccattttcaggggcgctaccacctgttttatcagtggagcccg
ctgggctgtgcgcatcagcataaatgctgggggcactggagctcggcggatctgacgcac
tggcaacacgagccgctggcgctgatgccggatgaagagtatgaccgcagcggctgttat
tccggcagcgcggtgaatgacaacgggcggctgacgctctgttacaccggcaacgtaaag
tttgacgatggcacccgcaccgcctggcagtgtctggcggtgcagaacgcggacggcggt
ttcgacaagctcggcccggtgatgccgctgcccggcggctataccggccacgtgcgcgac
ccgaaagtctggcgtcacggcgagcactggtacatggtgctgggcgcgcaggatctggaa
ttgcagggcaaagtgctactgctgcgatccgacactctgtggaactgggaaaacctgggc
gagatcgccggcagcacgctcggcgggcttggcgaggcgggttacatgtgggagtgcccg
gatctcttcatgctggatggcaaagcgattctgattacctgtccgcagggggtggcgcgc
gaagaaaaacgctatctcaacacctatccgagcgcgtacctgtgcggcgatctcaattac
gacacgccggaatttcgtcacggcccgctgatggagctggacgccggttttgagttttat
gcgccgcaaaccacgctcgccgacgatggccgccggttactcattggctggatgggcgtg
ccggacggcgaagagatgttgcagccgacggtggcgcagggctggatccaccagatgacc
tgcccgcgcgaactctcgcttcgcgatggcttgctctgccagcagccggtgcgcgaactt
gccgcgctgcgcggcgaggaacagcgcctggagggcgtggccgccacgctctcgccgctc
gctgcagagagcctggagctgatgctggaagcgcagggcgaggtgacgctcgatttcgcc
gataccctgcgcctggaatggacgcgcgacggcctgcgtctggcgcgccggagcctggcc
tgcggcgagtggatgcatcgttactggcagggcgacgtccgccgcctgcacattttgtgc
gaccgctcgagcgttgagattttcattaacgacggcgaaggcgtgatgagcagccgctat
ttcccggcggccaacgcgacgcttggttttgagggcgacgcgcaactccggctgcgctac
tggtcgttacgcgcctgcatggtagaatga

DBGET integrated database retrieval system