KEGG   Cronobacter sakazakii ES15: ES15_3666Help
Entry
ES15_3666         CDS       T02119                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    ES15_3666 (pldB)
Enzymes [BR:csk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     ES15_3666 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3982931..3983866)
Genome map
AA seq 311 aa AA seqDB search
MGALTDFWQQREEDEFLGVDNIPVRFVRFRAENHDRVIVVCPGRIETYVKYAELAYDLFH
CGFDVLIIDHRGQGRSGRLLEDTHRGHVVNFSDYVDDFERFWQQEVATGPWRKRYLLAHS
MGGAIGTLFLLRNPKAFDAVALCAPMFGIIIRLPDWMLRSILDWAEEYPSLRDGYAIGTG
RWRPLPFSLNMLTHSHERYRRNLRFYADEPQLRVGGPTYHWVREGIQAGEQVLAGATDST
TPLLLLQAELERVVDNRSHDRFCELRAAAGHPCWGGKPYVIKGAYHEILFEQDAMRAEAL
NAIVDFFDEHN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgctgacggatttctggcaacagcgcgaagaagatgagtttttgggcgtcgat
aatattccggtgcgctttgtgcgttttcgtgcggaaaaccacgatcgcgttatcgtcgtc
tgccccggccgtatcgaaacctacgttaagtatgcggaactggcatacgatctgttccac
tgcgggtttgatgtgctgattatcgaccaccgcgggcaggggcgttccgggcggttgctg
gaagatacccaccgcggccacgtggtgaatttcagcgattatgtcgatgatttcgaacgt
ttctggcagcaggaggtggcgaccggcccgtggcggaaacgctatctgctggcgcattcg
atggggggcgcgattggcacgctgtttctgctgcgtaacccaaaagcgtttgatgccgtg
gcgctctgcgcgccgatgttcggcattattatccgcctcccggactggatgctgcgctcg
atcctcgactgggctgaagagtatccgtcgctgcgcgatggttacgctatcggcaccggg
cgctggcgaccgctgccctttagtctcaacatgctgacgcacagccacgagcgctaccgg
cgcaatttgcgtttttacgccgatgaaccgcagctgcgcgtcggcgggcctacgtatcac
tgggtgcgggaaggcatccaggcaggagaacaggtgctggcgggggccaccgacagcacc
acgccgctattgttactccaggcagagctggaacgtgtggtggataaccgctcgcacgac
cgcttctgtgaacttcgcgccgcggcgggccatccgtgttgggggggtaaaccttacgtc
atcaaaggtgcgtaccatgagatcctgtttgagcaggacgctatgcgcgccgaagcgctg
aatgccattgtcgattttttcgacgaacataactga

DBGET integrated database retrieval system