KEGG   Cronobacter sakazakii ES15: ES15_3749Help
Entry
ES15_3749         CDS       T02119                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    ES15_3749 (glpK)
Enzymes [BR:csk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     ES15_3749 (glpK)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ES15_3749 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4093524..4095041
Genome map
AA seq 505 aa AA seqDB search
MMTTEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQS
STLVEALAKADISSDQIAAIGITNQRETAVVWERETGKPIHNAIVWQCRRTSEICEKLKR
DGMEDYVRQATGLVIDPYFSGTKVKWILDHVDGARERAKRGELLFGTVDTWLIWKMTQGR
VHVTDYTNASRTMLFNIHDLDWDDRMLEALDIPRAMLPQVRKSSEVYGQTNIGGKGGTRI
PIAGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVASTHGLLTTIACGPRGE
VNYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWD
PYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNF
LMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETT
ERNYRYEGWRKAVKRAMAWEEHDKE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgactacagaaaaaaaatatatcgttgcgctcgaccagggcacgaccagctcccgc
gccgttgtgctggatcatgacgccaacatcgtcagcgtctcccagcgtgaatttgaacaa
atctacccgcgtccaggctgggtagaacacgacccgatggaaatctgggcctcccagagc
tccacgctggtggaagccctcgcgaaagcggatatcagttccgatcaaattgccgctatc
ggcattaccaaccagcgcgaaacggcggtggtctgggagcgtgaaaccggtaaaccgatt
cataacgccattgtctggcagtgccgccgtacctcagagatttgcgaaaaactgaaacgc
gacggcatggaagattacgtgcgccaggcgaccggcctcgtgattgacccgtacttctcc
ggcaccaaggtgaagtggatccttgatcacgtcgacggtgcccgtgaacgcgcgaagcgc
ggcgaactgctgttcggcaccgtcgatacctggcttatctggaaaatgacccagggccgc
gtgcatgtgaccgactataccaacgcctcgcgcaccatgctgttcaacatccatgacctc
gactgggatgacagaatgctggaggcgctggatattccgcgcgccatgctgccgcaggtg
cgtaaatcgtctgaagtgtacggccagaccaacatcggcggtaaaggcggcacccgtatt
cctatcgccggtatcgcgggcgaccagcaggcggcgctgtttggccagctctgcgtgaaa
gaaggcatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcgaa
aaagcggtggcctccacccacggcctgctgaccaccatcgcctgcggcccgcgcggtgaa
gtgaactatgcgctggagggcgcggtgtttatggcgggtgcgtcgattcagtggctgcgc
gacgagatgaagctcatcagcgacgcgtttgactccgaatatttcgccaccaaagtgaaa
gacaccaacggcgtctatgtggtaccggcgtttaccggcctcggcgcgccatactgggat
ccgtatgcccgcggcgcgattttcggtctcacccgcggcgtgaactcgaaccacatcatt
cgcgccacgctggaatccatcgcctaccagacccgcgacgtgctggaagcgatgcaggcc
gactccggcattcgtctgcacgccctgcgcgtggatggcggcgcggtggcgaacaacttc
ctgatgcagttccagtctgacattctcggcacccgcgtggagcgcccggaagtccgtgaa
gtcaccgcgctgggcgcagcctatctggcgggtcttgcggtcggctactggcagaatctg
gacgaactgcaggaaaaagcggtaattgagcgtgaattccgcccgggtattgaaaccacc
gagcgtaactaccgctacgaaggctggcgcaaggcggttaaacgcgctatggcctgggaa
gagcacgacaaagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system