KEGG   Cronobacter sakazakii ES15: ES15_3749Help
Entry
ES15_3749         CDS       T02119                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:csk00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4093524..4095041
Genome map
AA seq 505 aa AA seqDB search
MMTTEKKYIVALDQGTTSSRAVVLDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWASQS
STLVEALAKADISSDQIAAIGITNQRETAVVWERETGKPIHNAIVWQCRRTSEICEKLKR
DGMEDYVRQATGLVIDPYFSGTKVKWILDHVDGARERAKRGELLFGTVDTWLIWKMTQGR
VHVTDYTNASRTMLFNIHDLDWDDRMLEALDIPRAMLPQVRKSSEVYGQTNIGGKGGTRI
PIAGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVASTHGLLTTIACGPRGE
VNYALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWD
PYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNF
LMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGYWQNLDELQEKAVIEREFRPGIETT
ERNYRYEGWRKAVKRAMAWEEHDKE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgatgactacagaaaaaaaatatatcgttgcgctcgaccagggcacgaccagctcccgc
gccgttgtgctggatcatgacgccaacatcgtcagcgtctcccagcgtgaatttgaacaa
atctacccgcgtccaggctgggtagaacacgacccgatggaaatctgggcctcccagagc
tccacgctggtggaagccctcgcgaaagcggatatcagttccgatcaaattgccgctatc
ggcattaccaaccagcgcgaaacggcggtggtctgggagcgtgaaaccggtaaaccgatt
cataacgccattgtctggcagtgccgccgtacctcagagatttgcgaaaaactgaaacgc
gacggcatggaagattacgtgcgccaggcgaccggcctcgtgattgacccgtacttctcc
ggcaccaaggtgaagtggatccttgatcacgtcgacggtgcccgtgaacgcgcgaagcgc
ggcgaactgctgttcggcaccgtcgatacctggcttatctggaaaatgacccagggccgc
gtgcatgtgaccgactataccaacgcctcgcgcaccatgctgttcaacatccatgacctc
gactgggatgacagaatgctggaggcgctggatattccgcgcgccatgctgccgcaggtg
cgtaaatcgtctgaagtgtacggccagaccaacatcggcggtaaaggcggcacccgtatt
cctatcgccggtatcgcgggcgaccagcaggcggcgctgtttggccagctctgcgtgaaa
gaaggcatggcgaaaaacacctacggcaccggctgctttatgctgatgaacaccggcgaa
aaagcggtggcctccacccacggcctgctgaccaccatcgcctgcggcccgcgcggtgaa
gtgaactatgcgctggagggcgcggtgtttatggcgggtgcgtcgattcagtggctgcgc
gacgagatgaagctcatcagcgacgcgtttgactccgaatatttcgccaccaaagtgaaa
gacaccaacggcgtctatgtggtaccggcgtttaccggcctcggcgcgccatactgggat
ccgtatgcccgcggcgcgattttcggtctcacccgcggcgtgaactcgaaccacatcatt
cgcgccacgctggaatccatcgcctaccagacccgcgacgtgctggaagcgatgcaggcc
gactccggcattcgtctgcacgccctgcgcgtggatggcggcgcggtggcgaacaacttc
ctgatgcagttccagtctgacattctcggcacccgcgtggagcgcccggaagtccgtgaa
gtcaccgcgctgggcgcagcctatctggcgggtcttgcggtcggctactggcagaatctg
gacgaactgcaggaaaaagcggtaattgagcgtgaattccgcccgggtattgaaaccacc
gagcgtaactaccgctacgaaggctggcgcaaggcggttaaacgcgctatggcctgggaa
gagcacgacaaagagtaa

DBGET integrated database retrieval system