KEGG   Cronobacter sakazakii ES15: ES15_3797Help
Entry
ES15_3797         CDS       T02119                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
csk  Cronobacter sakazakii ES15
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ES15_3797 (tpiA)
   01230 Biosynthesis of amino acids
    ES15_3797 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ES15_3797 (tpiA)
   00051 Fructose and mannose metabolism
    ES15_3797 (tpiA)
   00562 Inositol phosphate metabolism
    ES15_3797 (tpiA)
Enzymes [BR:csk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ES15_3797 (tpiA)
Exosome [BR:csk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ES15_3797 (tpiA)
  Exosomal proteins of bladder cancer cells
   ES15_3797 (tpiA)
  Exosomal proteins of melanoma cells
   ES15_3797 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4143823..4144590
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVSGCDVAIAPPAMYLDLAKQAAAGSHII
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHAESDELIAKKFAVLKAQG
LVPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGVVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKIAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEEAKKA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gagctggtagctaacctgcgtaaagagctggctggcgtatctggctgcgacgtagcgatc
gccccgccggcgatgtatctggatctggcaaagcaggccgctgctggcagccacatcatt
cttggcgcccagaacgtcgacgttaacctctccggcgcgttcaccggtgaaacttccgct
gaaatgcttaaagatatcggcgctaaatacatcattatcggccactccgagcgtcgtact
taccacgcggaatctgacgagctgatcgcgaaaaaattcgccgtgctgaaagcgcagggt
ctggtgccggtactgtgcatcggtgaaaccgaagctgaaaatgaagcgggcaaaacggaa
gaagtctgcgcacgtcagatcgacgctgtgctgaaaacccagggcgccgcggcgtttgaa
ggcgttgtgattgcttacgaaccggtatgggctatcggtaccggcaaatccgccactccg
gcgcaggcacaggcggttcacaaattcatccgtgaccacatcgccaaagccgacgcgaaa
atcgccgagcaggttatcattcagtacggcggttctgtaaacgcggctaacgcggcagag
ctgttcacccagccggacatcgacggcgcgctggtgggcggtgcctctctgaaagcggac
gcgttcgcggttatcgtgaaagccgctgaagaagcgaaaaaagcgtaa

DBGET integrated database retrieval system