KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_12516Help
Entry
COCSUDRAFT_12516  CDS       T02914                                 

Definition
MYST family histone acetyltransferase
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     COCSUDRAFT_12516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 394 aa AA seqDB search
MQVQLPLQIGTRVDCRWRDGEYYTARVVERRLLDGSEVHEYYVHYLKFNRRMDEWVKLEN
LNLNTVDVADIEGPDNKGSKKRRAGDELEDEHHGDFDPNELRQHEEFTKVKNVDKIELGR
YELETWYFSPLPPEYNNCKCLYFAEYDLAFFKTRDEMIRHLRKCKLQHPPGDEIYRNNTS
RNLTSEQVDGKKEKQYCQNLCYLAKLFLDHKTLYYDVDLFLFYVLCENDERGSHIVGYFS
KEKCSEEGYNLACILTLPSYQRKGYGKFLIAMSYELSKIEGKVGTPERPLSDLGNVSYRG
YWTRELLKVLQVREGSVSIKELSDITAIKTDDIISTLQHLNLIQYQKGQHVICAAPSVID
RTLKAAGSPGLEVDPSKIVWTPYSAEAEYRQFRN
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtgcaactcccgctgcaaattggcacgcgagtggattgcagatggcgagatggg
gagtactacacagcaagggtggtggagaggcggctgttggatggctctgaggtccatgag
tactatgtgcactacctcaaattcaacagaaggatggatgagtgggtgaagctggagaac
ttgaatttgaacacagtggacgtggcagacattgagggcccagacaacaaagggtcaaag
aagcgcagggcaggggatgagttggaggatgagcaccacggcgactttgatcccaacgag
ctgaggcagcacgaggagttcactaaggtgaagaacgttgacaagatcgagcttgggcgg
tatgagctggagacgtggtacttctcaccactcccgcccgagtacaacaactgcaagtgt
ctgtactttgcggagtatgatctggcgttcttcaagacccgggacgagatgattcgccac
ctgcgcaagtgcaagctgcagcaccctcccggcgatgagatctatcgcaacaacaccagc
cgtaatctgacttctgagcaggtggatggcaagaaggagaagcagtactgccagaacctg
tgctacctggcaaagctgttcctggaccacaagacgctctactacgacgtggaccttttt
ctgttctatgtcctctgtgagaacgatgagaggggatcccacatcgttgggtacttctca
aaggagaagtgcagcgaggaaggctacaatctggcttgcatcctgacgctgccatcatat
cagcgcaagggctacggcaagtttctgatcgcgatgagctatgagctgtccaagattgag
ggcaaagtgggcacgcctgagcggcccctgtctgacctgggcaacgtgtcctacagaggg
tactggactcgcgagctgctcaaggtgctgcaggtgcgcgagggcagcgtgtccatcaag
gagctgagtgacatcaccgccatcaagacggatgacatcatcagcaccctgcagcacctc
aacctcatccagtaccagaaggggcagcacgtcatctgcgccgcgccatccgtcatcgat
cgcaccctcaaagccgccggctctcctggcctcgaagtggatcctagcaagattgtgtgg
acgccatactcggctgaggctgagtaccggcagttcaggaactag

DBGET integrated database retrieval system