KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_13968Help
Entry
COCSUDRAFT_13968  CDS       T02914                                 

Definition
SIR2-family protein HDAC1
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     COCSUDRAFT_13968
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 429 aa AA seqDB search
MSLGYAEKLSFREDLGGQLGAPELLDDHDALQKSIEALSELVRESDNIIVFTGAGISTAC
GIPDFRGPQGVWTLQRAGKPLPKPKSSFTVARPSLTHMAIVGLMQRGKVRYVVSQNVDGL
HLRSGVPRSKIAELHGNCFAERCPRCKKEYIRDFEIETVGFRQTGRTCSVEGCKGKLKDH
ILDWEDALPEDELTASEDAVSAADLAICLGTSLQITPACNLPLRTPKAGGKLVIINLQAT
PKDKKASLVIHGRADEVMRRVMANLAFPIPSYVREDSVTIGHVQEQPMGSGKGHPFNVRI
SSVHGENCAMPLVQTIDISFPDHPSLRPATLRSAPFQLRRTVAQPGSYPVSIQLHLVEGL
DEPTVTLQYVAHILSQESFNDQLVIDTTSTQRKRKRQAVGHSITASFVTQEVDFHSSSSS
ADETHENGA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttggatacgctgagaagctctcgttcagagaagatttaggtggacagttgggc
gccccagaattgcttgacgaccatgatgcattgcagaagagcatagaggccctttctgaa
ctggtgcgtgagagtgacaatatcatagttttcactggagctggcatctccacggcgtgc
ggaataccagacttcaggggtcctcagggcgtgtggaccctgcagcgtgcaggcaaaccc
ctaccaaaaccaaaaagcagtttcactgttgcgcgtccgtctttgacacacatggctatc
gttgggctgatgcaaagggggaaagtgcgctatgtggtcagccagaatgtggacgggctg
cacttgcgatctggggtaccccggtctaagatagccgaactgcatggaaactgcttcgct
gagcggtgccctcgatgcaaaaaggagtacatccgtgactttgagattgagacggtcgga
ttcaggcaaacagggaggacatgcagcgttgagggctgcaagggcaagctaaaagatcac
atccttgattgggaggatgctttgccagaggacgaactgacagcatcagaggacgctgtc
agcgcagctgaccttgccatctgcctggggaccagtctgcagatcacacctgcttgcaat
cttcccctgcggactcccaaagcagggggcaaattggtgatcatcaacctccaggcaacg
ccaaaggacaagaaagcatccctggtcatacatggtagagcagacgaggtcatgcgcagg
gtgatggccaatttagctttccccatcccttcctatgtcagggaagactctgtcaccatt
ggtcatgtgcaagagcagcccatgggcagcggcaagggccaccccttcaacgtgcggatc
agcagtgtccacggcgagaattgtgcaatgcccctcgtgcagacgatcgacatatcattc
ccggaccatcccagcttgcggcctgccacattgcgctcagcgccgtttcagctcaggcgc
acagtcgcgcagccaggatcttaccctgtcagcatccagctgcacctggtagagggcctt
gacgagcccactgtgaccctgcagtacgttgcacacatactgtcccaggagagcttcaac
gaccagcttgtcattgacaccaccagcacccagcgcaagcgcaaaaggcaggcagtgggg
cacagcatcactgccagctttgtgactcaggaagtggactttcacagcagcagcagcagc
gcagacgagacacatgagaacggggcttga

DBGET integrated database retrieval system