KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_14606Help
Entry
COCSUDRAFT_14606  CDS       T02914                                 

Definition
(RefSeq) PfkB-type carbohydrate kinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COCSUDRAFT_14606
Enzymes [BR:csl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     COCSUDRAFT_14606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-GeneID: 17042118
NCBI-ProteinID: XP_005648664
JGI: 14606
UniProt: I0Z0F1
AA seq 316 aa AA seqDB search
MQATSQQEIRDLKSLVVVGSINADLVLEVERLPKDGETLGASSLNTFPGGKGANQAAAAA
RLQHPTYIIGQVGKDANASLLRDALSDSGVRLDHLKEVDGPSGTAVILLQPSGENSILIV
GGANTAAWDFDDAALQLLRSAGAVLLQREIPEEVNVHVASIAAAAGVPVLLDCGGVEGPI
SPDLLKNISILSPNETELARLTGRKTESEEEAEAAAQVMLEQGADTVLVKRGTSGSLQVS
TDGRIKQPIFLVDTVVDTTGAGDCFTGAYAVAILEGKGAAESLRFAAAASALCVQKAGAM
PSLPYREEVLRLLEEA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctacatcacaacaagaaattcgggacctgaaatctcttgtggtggtgggatcc
atcaatgctgatctggtcctagaagtggagaggctccccaaggatggtgagacactcggg
gctagcagcctgaacacattcccaggtggaaagggagcaaatcaggctgctgctgcagca
cgtttgcagcaccctacctacatcatcggtcaggtgggcaaggacgccaatgcctcgctt
ttgagggatgcgctgtccgactcgggagtgcgcttggatcacttgaaagaagtggatggg
cccagcggcacagcagtcatcctcctgcagccatccggtgagaacagcattttgatagtg
gggggcgccaacacagctgcatgggattttgatgatgctgcgcttcagcttctgcgcagc
gccggggctgtgctgctccagagggagatcccagaggaggtcaatgtgcatgtggccagc
attgctgcagcagctggggtgccagtgctgctggactgtggtggagttgaggggccgatc
tcgccagatctgcttaagaacatcagcatcctgtccccgaatgagactgagctcgcccgg
ctgactggtaggaagactgagtcagaagaggaagcagaagctgcagcacaggtgatgcta
gagcagggcgcagacactgtcctggtcaagcgaggaaccagcggctcattgcaagtcagc
actgacggacggataaaacaacctattttcttggtggacacggttgttgacacgactggg
gcgggtgactgcttcactggagcctatgctgtggcaatcttagaaggaaagggagcagct
gaatcgctgagatttgcagctgcagccagcgccctgtgcgtgcaaaaggcaggagccatg
ccaagccttccatatcgtgaagaggtactaagattgctggaggaagcatga

DBGET integrated database retrieval system