KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_14606Help
Entry
COCSUDRAFT_14606  CDS       T02914                                 

Definition
PfkB-type carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    COCSUDRAFT_14606
Enzymes [BR:csl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     COCSUDRAFT_14606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 316 aa AA seqDB search
MQATSQQEIRDLKSLVVVGSINADLVLEVERLPKDGETLGASSLNTFPGGKGANQAAAAA
RLQHPTYIIGQVGKDANASLLRDALSDSGVRLDHLKEVDGPSGTAVILLQPSGENSILIV
GGANTAAWDFDDAALQLLRSAGAVLLQREIPEEVNVHVASIAAAAGVPVLLDCGGVEGPI
SPDLLKNISILSPNETELARLTGRKTESEEEAEAAAQVMLEQGADTVLVKRGTSGSLQVS
TDGRIKQPIFLVDTVVDTTGAGDCFTGAYAVAILEGKGAAESLRFAAAASALCVQKAGAM
PSLPYREEVLRLLEEA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaggctacatcacaacaagaaattcgggacctgaaatctcttgtggtggtgggatcc
atcaatgctgatctggtcctagaagtggagaggctccccaaggatggtgagacactcggg
gctagcagcctgaacacattcccaggtggaaagggagcaaatcaggctgctgctgcagca
cgtttgcagcaccctacctacatcatcggtcaggtgggcaaggacgccaatgcctcgctt
ttgagggatgcgctgtccgactcgggagtgcgcttggatcacttgaaagaagtggatggg
cccagcggcacagcagtcatcctcctgcagccatccggtgagaacagcattttgatagtg
gggggcgccaacacagctgcatgggattttgatgatgctgcgcttcagcttctgcgcagc
gccggggctgtgctgctccagagggagatcccagaggaggtcaatgtgcatgtggccagc
attgctgcagcagctggggtgccagtgctgctggactgtggtggagttgaggggccgatc
tcgccagatctgcttaagaacatcagcatcctgtccccgaatgagactgagctcgcccgg
ctgactggtaggaagactgagtcagaagaggaagcagaagctgcagcacaggtgatgcta
gagcagggcgcagacactgtcctggtcaagcgaggaaccagcggctcattgcaagtcagc
actgacggacggataaaacaacctattttcttggtggacacggttgttgacacgactggg
gcgggtgactgcttcactggagcctatgctgtggcaatcttagaaggaaagggagcagct
gaatcgctgagatttgcagctgcagccagcgccctgtgcgtgcaaaaggcaggagccatg
ccaagccttccatatcgtgaagaggtactaagattgctggaggaagcatga

DBGET integrated database retrieval system