KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_20858Help
Entry
COCSUDRAFT_20858  CDS       T02914                                 

Definition
(RefSeq) glycoside hydrolase
Organism
csl  Coccomyxa subellipsoidea
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_14 Glyco_hydro_42
Motif
Other DBs
NCBI-GeneID: 17036173
NCBI-ProteinID: XP_005642810
JGI: 20858
UniProt: I0YIP7
AA seq 473 aa AA seqDB search
MPSTSLPVYVMLPLDTIWLLERDGKSIPVIKREKALEVGLQTLRQAGVEGVMVDVWWGIV
ENAGPGKYDFSAYKRLFHKVAESGLKVQAVMSFHAAGGNVGDTCKISLPKWVQAVGAENP
DIYYTDRSGTRNRECLSLGCDSEPLFHGRTPVELYKGFIEAFADNFDYLFGDVITEITVG
LGPAGELRYPSYPEGDGRWRFPGVGEFQCFDRYMMASLRRAAEAVGHPEWGYDGPHDCGN
YNSAAWETGFFVSQGGSWDTEYGHFFLGWYSSLLLQHADRVLKAAAASLNKRGRPRKARA
AREHTDGHVVYEFDAACHLGVKLAGVHWWFKSRAHAAELTAGYYNTRERDGYAELMAMLR
RNNARLSFTCVEMRDCEHPPEGRCSPQGLLQQVIEAAAAAGVPLSGENALQRYDHYAFDR
IAESAFGLNARAGRLEQLTFLRMGDLMFDNWDAFSSFLHRLRSPPSTPNWTGY
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgaccagccttcctgtctatgtgatgctgccgttggacaccatctggctgctg
gagagggatgggaagtcgatcccggtgatcaagcgggagaaggcgctagaggttgggctg
cagacactgcggcaggcgggtgtagagggggtcatggtggatgtctggtggggcattgtg
gagaacgcaggccccggcaaatatgacttctctgcatacaagcgtctgttccacaaggtg
gcggagagcgggctgaaggtgcaggcggtgatgtcattccacgcggcaggggggaacgtg
ggggacacctgcaagatctcgctgcctaaatgggtgcaggcagtgggcgcagagaatccg
gacatttactacacggaccgctctggcacgcgcaaccgcgagtgcctcagtctcggctgc
gacagcgagcccctgttccacggccgcacccccgtggagctctacaagggcttcatcgag
gcctttgcggacaactttgactacctttttggggatgtcatcacggagatcacagtggga
ttggggccggcgggggagctgaggtatccgtcatacccggagggcgacggccgctggcgc
ttcccgggcgtcggagagttccagtgctttgaccgctacatgatggcctccctgcgccgc
gcagccgaggccgtaggccaccccgagtggggctacgacggcccgcacgactgcggcaac
tacaacagtgcggcgtgggagacgggcttctttgtgagccagggcggcagctgggacacg
gagtatggccacttcttcctgggctggtactcctcgctgttgctgcagcatgccgaccgt
gtgctcaaggccgccgccgcctccctcaacaagcgcggccggccccgcaaagcgcgcgcc
gcccgcgagcacaccgacggccacgtcgtctacgaattcgacgccgcctgtcatctgggt
gtcaagctggccggcgtgcactggtggttcaagtcgcgcgcgcatgccgcggagctgaca
gcagggtactacaacacgcgcgagcgcgacggctacgcagaactgatggccatgctgcgg
cgcaacaatgcgcggctgtccttcacctgcgtggaaatgcgcgactgcgagcacccacca
gagggccgctgctccccgcaggggctgctgcagcaggtgatcgaggcggccgcagcggcg
ggcgtgcccctgagcggcgagaacgcgctgcagcgctacgaccactacgcgttcgaccgc
atcgcagagagcgcctttggcctgaacgcgcgcgccggccgcctggagcagctcaccttc
ctgcgcatgggcgacctcatgtttgacaactgggacgccttctccagcttcctccaccgc
ctgcgctcgcccccctccacccccaactggaccggttactaa

DBGET integrated database retrieval system