KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_23319Help
Entry
COCSUDRAFT_23319  CDS       T02914                                 

Definition
alanine aminotransferase 2
Orthology
K00814  
alanine transaminase [EC:2.6.1.2]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Alanine, aspartate and glutamate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCSUDRAFT_23319
   01210 2-Oxocarboxylic acid metabolism
    COCSUDRAFT_23319
   01230 Biosynthesis of amino acids
    COCSUDRAFT_23319
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COCSUDRAFT_23319
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSUDRAFT_23319
Enzymes [BR:csl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     COCSUDRAFT_23319
Amino acid related enzymes [BR:csl01007]
 Aminotransferase (transaminase)
  Class I
   COCSUDRAFT_23319
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 505 aa AA seqDB search
MVANGAVDSVKGPQPSCSPLALENINPKVVKAQYAVRGEIVIRAKELEDKLHAGEKLPFD
KILYCNIGNPQQLGQHPVTFYRQVLAICDYPELLESAEAKSIFPPDVLARAKKYLAAIPG
GTGAYSDSRGAMVLRQDIAKGIEERDGYPCDPDNLFLTDGASQGVHAMMRLLLRDEKDAV
LTPIPQYPLYSATLTMYGGVLLPYYLHEETGWSLDINELREQTYKARSEGQNVRALVVIN
PGNPTGQILSYENQVDVVKFCKEEGIVLLADEVYQANIYRPDKTFTSFKKARPFLSSQPR
CLHACEEEVTLASMMSISKGFYGECGRRGGYTELVNVDPSVLSEVYKLASINLCSNLNGQ
ICMALVMNPPKEGEPSYDLYAKERTELLASLKRRALKLHKTLSALQGVTCTEPEGALYAM
PQIRLPQGAIEAAKKTGKAADFFYCMQLLEETGIVTVPGSGFKQEEGTFHFRTTFLVPEP
ETDEVAERLVKFHNSFLAKYGEPEQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgaacggtgctgtggactctgtgaaggggcctcagccttcttgttcacccttg
gccttggaaaacataaaccccaaagtggtcaaggcacagtatgctgtaaggggcgaaatc
gtgattcgtgccaaggagctggaagacaagcttcatgctggggaaaagctcccatttgac
aagattctgtactgcaacattggcaatccccagcagctagggcagcaccctgtaaccttc
tacagacaagtgctggccatttgtgactacccagagctactggagagtgcagaggcgaag
agcattttcccgccagatgtgcttgcgcgtgccaagaagtacctggccgccattccagga
ggcactggggcatacagcgacagtagaggtgccatggtgctccggcaggatattgccaag
ggcatcgaggagcgagatgggtacccctgcgatcctgacaatctgttcctaacagatggt
gccagccagggcgtgcatgcgatgatgcgcctgcttctgcgcgatgagaaggacgctgtc
ctcacacccattccccagtaccccctctactcggcgacattgacgatgtacggaggcgtg
ctgttgccctactacctccatgaagagaccggctggagcctggacatcaatgagctgcgc
gagcaaacctacaaggcgcggtcggaggggcagaatgtgagggcgctggtggtgatcaac
cctggcaatcccaccggccagatcctgtcgtatgagaaccaggtggacgtggtcaagttc
tgcaaggaggagggcatcgtgctgctggcagacgaggtgtaccaggccaacatctaccgc
cccgacaagaccttcacctccttcaagaaggcacgccccttcctctcctctcagccacgc
tgtttgcatgcatgtgaggaggaagtgacgctggcctcgatgatgtccatctccaagggc
ttctatggcgagtgcggccggcgcggcggctacacggagctggtcaacgtggaccccagc
gtgctctccgaggtctacaagctggcctccatcaacctctgctccaacctcaatggccag
atctgcatggccctcgtcatgaacccccccaaggagggggagccgtcgtatgatttgtat
gcgaaggagcgcacggagctgctggcgtcgctgaagcggcgggcgctgaagctgcacaag
acgctgagcgcgctgcagggcgtcacctgcacagagcccgagggcgccctctacgccatg
ccccaaatccgtctgccccagggcgccattgaggctgccaagaagacgggcaaggctgcg
gacttcttctactgcatgcagctgctggaggagactggcatcgtgactgttccaggttca
ggcttcaagcaggaggagggtacgttccacttcaggaccacattcttggtgccagagcca
gagactgatgaggtggctgagcggctggtgaagtttcacaacagcttccttgccaagtat
ggggagcccgagcagtga

DBGET integrated database retrieval system