KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_23618Help
Entry
COCSUDRAFT_23618  CDS       T02914                                 

Definition
DUF906-domain-containing protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     COCSUDRAFT_23618
Transcription factors [BR:csl03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    COCSUDRAFT_23618
Mitochondrial biogenesis [BR:csl03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    COCSUDRAFT_23618
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 983 aa AA seqDB search
MRDARDKKEYVAKQQRWLLFLRHCAKCQAAEGQCTYGQSCTVAKQLWRHILTCADPNCEY
PRCLTSRELLKHHQKCVNQSCPVCTPVKQYVQKQRMVMQKQQQEAMARKEAEARGYNPHM
MQQRFKPGQAQAVMQGNHGTSLIEAMNALEIQSHLGTLKSVSVGEQAQAGQSSMGAKAPL
GSGLPAWSDPQSDPCAACGVCRYTFEPPSIFCTSCSQRIKRNQVYYTTPAKKSEGVKGFW
CHSCYSEHRGEIIQMEGMRVRKNELEKRKNDEETEEGWVQCDVCDCWVHQICGLFNKGRN
KEETPYVCPMCLMDGLRKGQRKAIAVRPQAMLEAKDLPRCDLSEFLEDRVAKALERDLHM
RAQRKGIPTDQVPAATGLTLRVINNVVKKMDTKSKFYDAFRKDGYPANFEYKQKARSVIM
LFQKQDGVDVCLYCLYMQEYPDSCPAPNSRWIYLSYLDSVKYFRPEGVMSAREGVALRTL
VYHEVLQGYLSYVKARGYTSMFIWACPPLQGDDYILYCHPSRQKTPRSEHLREWYLRMLR
QAQVEGSVTHLSNLWDTFFEGGRDHRIDRPSSTHLPYFEGDYWPGEAESLLMNMGEEARV
AGKKGSKPGRAAKNTKGKRYGSGPATTDTQLMEKLGDTISGMKADFIVVHMQEPCSFCRT
YISDATRCAPLPLHLMLPLCKLPSRVYPQDAAAGEGKARGLPSGVHLADLVPTKTEPIAA
THDEGNPEMHCEFFDTRQAFLSLCQGNHYQFDSMRRAKHSSMMVLYHLHNPDAPAFSCSC
NACGMEIEPGQGFRCSVCQDFDMCTNCKHTVGHQHQLIAHARKIDETRTRMTEEERTERN
AQLARTMALLVHASGCADPECPSSNCSKVKGLFHHAVSCPQKVAGGCQLCRRMWMLLQVH
AKQCQNNDCPVPRCRELREMRRRAVARQEDQRRVAYQAMLRNQNGQGGNSSQGPSGSQGK
GSGGGSGSQGKHPGGEIKRESQY
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacgctagggacaagaaggagtacgtggcgaagcagcagcggtggctgctcttc
cttcgccactgcgccaagtgccaagcagccgaggggcagtgcacctacggccagtcctgc
accgtcgccaagcagctctggcgccacatcctcacctgcgccgaccccaattgcgaatac
cccaggtgcctgacgagccgggagctgctgaagcaccaccagaagtgtgtaaatcagagc
tgcccggtgtgcacaccggtgaagcagtacgtgcagaagcagcgcatggtgatgcagaag
cagcagcaggaggccatggcgcgcaaagaggccgaggcccgcggctacaacccccacatg
atgcagcagcgtttcaagccggggcaggcgcaagcggtgatgcagggcaaccatggcacc
tccctcatcgaggccatgaacgccctggagatccagtcccacctgggaaccctcaagagt
gtatctgttggggagcaggcgcaggcggggcagagcagcatgggcgcaaaggcgccgctg
gggtcggggctgccggcctggagcgacccgcagtccgacccttgcgcggcctgcggcgtg
tgccgctacaccttcgagccgccctccatcttctgcacctcctgctcccagcgcatcaag
cgcaaccaggtgtactataccacgccggccaagaagagcgagggcgtgaagggcttctgg
tgccacagctgctactctgagcaccgcggcgagatcatccagatggagggcatgcgtgtg
cgcaagaatgagctggagaagcggaagaacgatgaggagacagaggaggggtgggtgcag
tgcgacgtgtgcgattgctgggtgcaccagatctgcggcctcttcaacaaggggcgcaac
aaggaggagacgccctacgtctgccccatgtgcctcatggacgggctgcggaaggggcag
cggaaggcgattgcggtgcggccgcaggcgatgctggaagcgaaggacctgccgcgctgc
gacctgagcgagttcctggaggatcgcgtggccaaggccctggagcgcgacctccacatg
cgcgcccagcgcaagggcatccccaccgaccaggtgccggcggcgacggggctgacgctg
cgggtgatcaacaacgtggtgaagaagatggacaccaaatccaaattctacgacgccttc
cggaaggacggctacccggccaacttcgagtacaagcagaaggcgcgttctgtgatcatg
ctgttccagaagcaggacggcgtggacgtgtgcctgtactgcctgtacatgcaggagtac
cccgacagctgccccgcccccaactcccgctggatctacctctcctacctggactccgtc
aagtacttcaggccggagggggtgatgagcgcgcgggagggagtggcgctgcggacgctg
gtgtaccacgaggtgctgcagggctacctgtcctacgtcaaggcccgcggctacacctcc
atgttcatctgggcctgcccgcccctgcagggtgacgactacatcctgtactgccacccg
agccggcagaagacgccgcgcagcgagcacctgcgcgagtggtacctgcgcatgctgcgc
caggcgcaggtggagggcagcgtcacacacctctccaacctgtgggacaccttcttcgag
ggcggccgcgaccaccgcatagaccgcccttcctccacccacctcccctacttcgagggc
gactactggccgggcgaggcggagagcctgctgatgaacatgggggaggaggcacgcgtg
gcgggcaagaagggcagcaagcccgggcgcgcggccaagaacaccaagggcaagcgctac
gggtcggggccggccactacggacacgcagttgatggagaagctgggcgacaccatctcc
ggcatgaaggccgacttcatcgtcgtgcacatgcaggagccctgctccttctgccgcacc
tacatctccgacgccacccggtgcgcgccgctccctcttcatctcatgctaccactgtgc
aagcttccctctcgcgtttatccgcaggatgcggcggctggcgagggcaaggcgcggggc
ctgccgagcggggtgcatctggcagacctggtgccgaccaagacggagcccatcgcggcc
acccacgacgagggcaatcccgagatgcactgcgagttcttcgacacccgccaggcgttc
ctgtcgctgtgccagggcaaccactaccagtttgacagcatgcggcgcgcgaagcacagc
agcatgatggtgctgtaccacctgcacaacccggacgcgccagccttctcctgctcctgc
aacgcttgcggcatggagattgagccggggcagggcttccgctgctccgtctgccaggac
ttcgacatgtgcaccaactgcaagcacaccgtcggccaccagcaccagctcatcgcgcac
gcgcggaagatcgacgagacgcggacgcggatgacggaggaggagaggacggagcgcaac
gcacagctggcgcgcacgatggcgttgctggtgcacgcgagcggctgcgcggacccggag
tgcccctcctccaattgctccaaggtcaagggcctcttccaccacgccgtctcctgcccc
cagaaggtcgccggcggctgccagctctgccggcggatgtggatgctgctgcaggtgcac
gcgaagcagtgccagaacaacgactgccccgtgccgcgctgccgcgagctgcgcgagatg
cgcagacgcgccgtggcccgccaggaggaccagcgccgcgtcgcctaccaggccatgcta
cgcaaccagaacggccagggcggcaactcgtcgcagggcccgtccgggtcgcagggcaag
ggctccggcggcggcagcggctcgcagggcaagcacccgggtggcgagatcaaacgtgag
agccagtactga

DBGET integrated database retrieval system