KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_26706Help
Entry
COCSUDRAFT_26706  CDS       T02914                                 

Definition
alanine aminotransferase
Orthology
K14272  
glutamate--glyoxylate aminotransferase [EC:2.6.1.4 2.6.1.2 2.6.1.44 2.6.1.-]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Alanine, aspartate and glutamate metabolism
Glycine, serine and threonine metabolism
Glyoxylate and dicarboxylate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Photorespiration
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCSUDRAFT_26706
   01210 2-Oxocarboxylic acid metabolism
    COCSUDRAFT_26706
   01230 Biosynthesis of amino acids
    COCSUDRAFT_26706
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    COCSUDRAFT_26706
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COCSUDRAFT_26706
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSUDRAFT_26706
   00260 Glycine, serine and threonine metabolism
    COCSUDRAFT_26706
Enzymes [BR:csl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     COCSUDRAFT_26706
    2.6.1.4  glycine transaminase
     COCSUDRAFT_26706
    2.6.1.44  alanine---glyoxylate transaminase
     COCSUDRAFT_26706
    2.6.1.-  
     COCSUDRAFT_26706
Amino acid related enzymes [BR:csl01007]
 Aminotransferase (transaminase)
  Class I
   COCSUDRAFT_26706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 523 aa AA seqDB search
MSLRRGLEQRSALWALCRSVSVAAGGPLTQRTHGFASLPDPIGDDSPPQNSKNGKVLHPD
LLNENLVRAEYAVRGELYLRGEELRKQGKEIIFTNVGNPHVLGQKPLTFNRQVLSLIASP
ALLEHPEVGRLFPSDAIARAKQVLTYFPGGMGAYSDSRGAEGVRKEIAEFISKRDGYPSN
PNNIFLTDGASPAVRYILNAIIRSDKDGILVPVPQYPLYSASIQLYGGELVGYNLKEETG
WSMDIADVKKSVDDARARGIAVRALVFINPGNPTGQCLSYQNLEDIIKFAHEENIVLMAD
EVYQTNIFQDERPFVSCKKVMMDMGAPYSEQELVSFHTISKGALGECGMRGGMLEATNIH
PDTIDQLYKIASINLSPNTFGQAGLALMVNPPKEGDPSHEQHEAEAAGIIASMRRRARMM
TDGFNACEGITCNYTEGAMYSFPRLNLPPKALQAAKKAGKAPDTWYCLKLLDATGVLTVP
GSGFGQEEGTFHLRTTILPQEDKIKDVIASFQKFHASFMDEYR
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgcgtcgtgggttggagcagcgcagtgcgctgtgggcgctttgccgttcagtg
tccgtcgctgcaggagggccattgactcagcgcactcacggcttcgcgtcgttaccagac
cccattggcgatgattctccaccacagaactcaaagaatggaaaggtcctgcatccagat
ctcctgaacgagaatctggtgcgcgctgaatatgccgtcaggggtgagttgtacctgagg
ggggaggagctgcgcaagcagggcaaagaaatcatctttacaaacgtgggaaacccgcac
gtcctgggccagaagcctctgaccttcaaccgccaggtgctgtcgcttattgcctcacca
gcgctgctggagcaccctgaggttggaaggctgttcccctcggatgcaatcgcgcgcgcc
aagcaggtgctcacctacttcccgggcggcatgggggcctacagcgactcccggggggcc
gagggggtgcgcaaggagatagcagagtttatctccaagcgggacggctatccttcaaac
cccaacaacatcttcctgactgatggcgcgtcgccggcggtacgctacattctcaatgcg
atcatacgcagcgacaaggacggtatcctggtgcccgtgccccagtacccgctctactct
gccagcatccagctctacggtggggagctggtggggtacaacctgaaggaggagaccggc
tggagcatggacattgcggacgtcaagaagagtgtggatgatgcgcgcgccaggggcatc
gccgtgcgcgctctggtcttcatcaaccctgggaacccgactgggcagtgcctgtcatac
cagaacctggaagacatcatcaagtttgcgcatgaggagaacattgtgctcatggcggac
gaggtgtaccagaccaacatcttccaggacgagcggccctttgtgagctgcaaaaaggtg
atgatggatatgggcgccccctacagcgagcaggagctggtgtccttccacacaatcagc
aagggcgcgctgggcgagtgcggcatgcgcggaggcatgctggaggcgaccaacatccac
cccgacaccatcgaccagctctacaagatcgcctccatcaacctgtcccccaacactttc
ggccaggctgggctggcgctgatggtgaacccaccgaaggagggcgacccgtcgcacgag
cagcacgaggcggaggcggcgggcatcattgcgagcatgcgccggcgcgcgcgcatgatg
accgacgggttcaacgcgtgcgagggcatcacctgcaactacaccgagggcgccatgtac
tccttcccgcgcctcaacctgccccccaaggcactgcaggcggccaagaaggccggcaag
gcgccggacacctggtactgcctcaagcttctggacgccaccggcgtgctgaccgtgccc
gggagcggatttgggcaggaggagggaacgttccacctgcgcaccaccattctaccgcaa
gaggacaagatcaaggatgtcattgccagcttccaaaagttccacgccagcttcatggac
gagtaccgctga

DBGET integrated database retrieval system