KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_27077Help
Entry
COCSUDRAFT_27077  CDS       T02914                                 

Definition
(RefSeq) hypothetical protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
csl  Coccomyxa subellipsoidea
Pathway
csl01040  Biosynthesis of unsaturated fatty acids
csl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    COCSUDRAFT_27077
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     COCSUDRAFT_27077
Lipid biosynthesis proteins [BR:csl01004]
 Desaturase
  First
   COCSUDRAFT_27077
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 17044542
NCBI-ProteinID: XP_005651076
JGI: 27077
UniProt: I0Z7B3
AA seq 423 aa AA seqDB search
MALLGLRGPHVVDAAAGCCHHSSAKRICTGLPRSAAHLRPHQLSHQTPSASSFCHHRRAR
SSLSVSAAAHSVQAGATLAEVDAPTEISRDQLAELSYSAQYDRLFQQLSQLDTKKPVPKP
SKEAQQEEDGAKKVLLSDVYATAKTTLFGRSWNGQDYGYTIFMLVVHGLCLLAPFTFSWP
MVGLFFGSYFITGCLGITLSFHRQLSHRSFTTPKWLEYALAYCGVLAVQGEPIEWVSSHR
YHHLHTDTPLDPHSPYEGFWWSHMGWLLNNGATLERVGSRGNTADLDSQPFYRFIQRTYP
WHVVGMFAALFAFGGLPAVVWGGALRAVWVYHITWFVNSASHCWGYQTYNTGDLSRNNWW
VAVLAFGEGWHNNHHAFEFSARHGLEWWQFDMTWQIVAALKVLGLADNVKLPSEKQKSRL
AFS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttctcggcctccgcggtccccacgttgtggatgctgctgcagggtgctgccac
cactccagtgccaagcgcatctgcactggcctcccacgaagtgctgcccacttgcggcct
catcagctgtcccatcagacccctagtgcttcatcattttgtcatcatagacgagccagg
tcgtcgctctcggtatcggcggcagcgcatagcgttcaggccggtgctaccctggctgag
gtggatgcgccaacggaaatatcccgagaccaactagcagagctttcatacagcgcgcag
tacgatcgtctgtttcaacagctgtcgcagctggacacaaaaaagcctgtccccaaacca
agcaaggaggctcagcaggaggaggatggagccaaaaaggtgttgctgtcggacgtgtac
gccaccgcaaagacaacgctgtttggccgaagctggaatgggcaggactatgggtacaca
atcttcatgctggtcgtgcacgggctgtgccttcttgcaccgttcaccttctcgtggccc
atggtgggactcttcttcggcagctacttcatcacgggctgcttggggatcacgctcagc
ttccacaggcagctgagccaccgcagcttcacgacgcccaagtggctggagtatgcgctg
gcgtactgcggcgtgctggcggtgcagggggagcccatcgagtgggtgtcctcccaccgc
taccaccacctgcacaccgacacgccgctggacccccactccccctatgagggattctgg
tggtcccacatgggctggctgctcaacaacggggcaaccctggagagggtgggttcgcgg
ggcaacacagccgacctggactcgcagcccttctaccgcttcatccagcgcacatacccc
tggcacgtggtgggcatgtttgccgcgctgtttgcctttggcggcctccctgcggtggtg
tggggcggagccctccgcgccgtctgggtctaccacatcacctggtttgtcaactctgcc
agccactgctggggctaccagacgtacaacaccggggacctgagccgcaacaactggtgg
gtggccgtgttggctttcggggagggctggcacaacaaccaccatgccttcgagttcagc
gcgcgccacggcctcgagtggtggcaatttgacatgacctggcagatcgttgctgcactg
aaggttttgggcctcgcagacaatgtcaagctgccttcagagaagcagaagagccgcctc
gcgttctcctga

DBGET integrated database retrieval system