KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_30296Help
Entry
COCSUDRAFT_30296  CDS       T02914                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
csl  Coccomyxa subellipsoidea
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 672 aa AA seqDB search
MSDQLASQPLLPALGLASVIVLVLSIVVLLYRHRSSKPGAGRKASIFLNGEQAANKEDDR
PKVCILFGTQTGTAERFSKQLKSELATRYGEGNRYEVLDMEEFKAEELHKETVVFFMMAT
YGDGEPTDNAADFYGWLLKASSDVDKGIGNGKLLEGVSFGVFGLGNKQYEHFCAVGKRVH
KALVNLGGRALVRRGDGDDDEDIEADFESWRTELYASLDKSDVLAKSTTGEPGVTQIVAA
AETVPSYQVEILTGADAAGAEDVSTDAPVSGNGTSKDSPFLARIGVVRELHSPQSDRSCV
HIELDVSGSDISYEAGDHVGILPENSSESVERAAAALGYPPETVFRLSVPEGNPQKMAQP
FAGGAITLRAALARYADLLSPVSKPALQALTAFADGEDAARLHRLLSPDGAAEYKAWHQQ
SRCLLEVLEEFPSIKPPLGVFFGSVMQRLQTRFYSISSSPLPHPKSIHVTCAVVLETTAT
GRVHEGITSYFLKQKAPGARVPVFVRHSSFRLPRDPAAPIVMVGPGTGLAPFRGFLQERA
ALAAKGTKLAPAYLFFGCRKRAHDYIYREELEAWAADGTITKLFVAFSRDGKTKDYVQHH
MARESALIAPVLREGAGAGGHFYVCGDAKHMAKDVARAAVAIVEQANGVSTGQAEAVLKR
MSDAGRIQKDVW
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccagctagcgtcgcagccgctgctgcccgcgctgggtctggcctcggtcatc
gttctggtgctctccatagtggtcctactgtatcggcatcgcagcagcaagccaggggcc
ggccgcaaggcctcaatattcctgaacggcgagcaggcagccaacaaggaggacgacaga
ccgaaggtctgcattctcttcggcacgcagaccgggactgcggagaggttctctaagcaa
ttgaagtcggaactggcaacacggtatggcgagggaaaccggtatgaggtgctggacatg
gaggagttcaaagcggaggagctgcacaaggagacagtggtttttttcatgatggccacc
tacggcgatggagagccgacagataatgcagcagacttctatgggtggctcctgaaggcc
tcctcggatgtggacaagggaatagggaacggcaagctcttggagggcgtgtcctttggc
gtttttggcctgggcaacaaacagtacgagcacttctgcgctgtgggcaagcgcgtgcac
aaggcgctggtcaacctaggaggtcgcgctctggtgcgccgcggcgacggcgacgatgac
gaagacatcgaggccgactttgagtcatggcggacggagctgtacgcctccctggacaag
tctgatgtgctcgccaagagcacgactggcgagccaggagtgacacagatcgtggcggcg
gcagaaacagtgcccagctaccaggtggagatcctgactggcgcggacgcggcgggggcc
gaggatgtttccactgatgcgccggtgtccggcaacggcaccagcaaggactcacccttc
cttgcgcgcatcggggtggtgcgcgagctgcactcgccgcagtccgaccgctcctgcgtc
cacattgagctggatgtcagcggctctgacatcagctatgaggctggagaccacgtgggc
atcctgccagagaacagcagcgagtcggttgagcgggcggcagccgcattagggtaccca
ccagagacagtgttcaggttgagcgtgcccgagggcaacccccagaagatggcgcagccc
tttgcaggtggcgcgatcacgctgagggcggcactggcgcggtatgcggatctgctgtcg
ccggtgagtaagccggcgctgcaggcgctgacagcatttgcggacggcgaggatgcggcg
cggctgcaccggctgctgtcgccagatggcgccgcggagtacaaggcgtggcaccagcag
agccgctgcctgctggaggtcctcgaagaattccccagcatcaagcccccgctgggcgtc
ttcttcggctctgttatgcagcggctgcagacgcggttctactccatctcatcgtccccc
ctgccgcaccccaaatccatccatgtcacctgcgccgtcgtcctggaaaccaccgccaca
gggcgggtgcacgagggcattacgtcgtacttcttgaagcaaaaggcgccgggcgcgcgc
gtgccggtgtttgtgcggcacagcagcttccggctgccgcgcgatccggccgcgcccatc
gtcatggtcggccccggcaccggcctcgcgccgttccgcggcttcctgcaggagcgcgcc
gccctcgccgctaaaggcaccaagctggccccggcgtacctgttctttggctgccgtaag
cgcgcgcacgactacatctaccgcgaggagctggaggcctgggcggcggacggcaccatc
accaagctcttcgtggccttctcgcgcgacggcaaaaccaaggattacgtgcagcaccac
atggcgcgcgagtcagcgctgatcgcccccgttcttcgcgagggcgccggcgccggcggt
cacttctacgtgtgcggggacgccaagcacatggccaaggatgttgcgcgggcggcggtg
gcaattgtggaacaggcgaatggcgtgagcacgggacaggctgaggccgttctcaagcgc
atgtcggacgccggccgtatccagaaggacgtctggtag

DBGET integrated database retrieval system