KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_30343Help
Entry
COCSUDRAFT_30343  CDS       T02914                                 

Definition
cytochrome-b5 reductase like protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    COCSUDRAFT_30343
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     COCSUDRAFT_30343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 307 aa AA seqDB search
MASLFGALRSTLGTKLFISGAAGAATLTALQSGWLKDARAEQAPPAGALDPNEWRSFKVV
SKDVITHNTSRLRFATPDPNQTSGLFVASCLLTRAPIGAKKEDGNQKFVIRPYTPTSAPD
QKGHFDLVVKGYPDGKMSKHIVNLNVGDSLECKGPISKLRYKPNMKKKIGMIAGGTGITP
MLQVASEVLRNPDDKTEVSLVFGNVSEDDILLRKEIDEMAKKHSNFKVYYVVDKPTSFFW
RGGKGYITEDTVKKHLPPPSDVSLILVCGPPPLMKAISGDKAEDKSQGELTGTLKSIGYT
SDQVYKF
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctagcctctttggagcacttcgctccacactaggaaccaagcttttcatcagtggt
gcagcaggtgcagcaacattgacagcactccagtcagggtggctcaaggatgccagagct
gagcaggccccacctgcaggagccttggatcccaacgagtggaggtcattcaaggttgtc
tcaaaggatgtgatcacccacaacacctctcgactaaggtttgccaccccggaccccaac
cagacaagcggcctctttgtggcttcctgcctgcttacacgcgcgccgatcggcgccaag
aaggaggatggaaatcagaagtttgtcatcagaccgtacacaccaacttctgcgcccgat
cagaagggtcattttgatctggtcgtcaaggggtatccggacggcaaaatgtcaaagcac
atagtcaacctcaacgtgggggacagcttggagtgcaaagggcccatctccaagctgcgc
tataaacccaacatgaagaagaagattggcatgattgctgggggcacggggatcacgcct
atgctgcaggtggccagcgaggttctgcgcaacccagatgacaagacagaggtgtctctg
gtatttggcaatgtttctgaggacgacattttgctgaggaaggagatcgatgagatggcg
aagaagcacagcaacttcaaggtatactatgtagtggacaagccaacgagcttcttttgg
agagggggcaagggttacatcactgaggacacagtgaagaagcaccttccccctccatca
gatgtgagtctgatcctggtgtgcggaccacctccacttatgaaggcaatttctggagat
aaagcagaggacaaaagccagggagagttgaccggcaccttgaagtcaattgggtacacc
tccgaccaggtgtacaagttttag

DBGET integrated database retrieval system