KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_33651Help
Entry
COCSUDRAFT_33651  CDS       T02914                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     COCSUDRAFT_33651
Transcription machinery [BR:csl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     COCSUDRAFT_33651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 474 aa AA seqDB search
MAEAEEPPYKKQKVDADTTVEDSLFERLQDNDAAQPLDAPAAAASSGQSGRADGAAVAEV
QLAAPLPANGIAESNAEPPTHEGDALLENGGIPLVEVPAGMFSQRELYMAKREADGDLAF
EYVDNDNTANHNMWLIGLKNIFSKQLPNMPKEYIARLVLDRRHRSVAIIRRGGTVLGGIT
YRPFHDQRFGEIAFCAVTAIEQVKGFGARLMNYTKEFARAHDHLTHFLTYADNNAVGYFA
KQGFTKEITLEKDRWVGFIKDYDGGTLMECIISDRLPYTDLPGMLRAQRAALDRHIRTLS
KSHVIHPGLTTFRDGQRRVEIASIPGVAEAGWTAEMAEPPHYNLLIDRMVLPVTPDNLQR
FMERAWRALYSLDDSWPFREPVDAEDVPDYYEIVKDPVDLSTIEQRLARRDYYVTLHIFI
ADVNRMCANARVYNSAETIYFKMANKLEAFLDEYIHSHVVFNNPQGCTPKKLPP
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcagaggagcccccatataagaagcagaaggtcgatgctgatacaacagta
gaagattcgctctttgaaagattacaggataatgacgcagctcaacctctggatgcgcca
gcagcagctgccagcagtggccaaagtggcagggcggatggggcagctgttgctgaagta
caactagcagctccattgcctgcgaacgggattgcagagagcaatgctgagccgcccact
catgaaggtgatgcactattggagaatggcggcatcccccttgtcgaggtgccagcaggg
atgttctcgcagcgcgagctgtacatggccaagagggaggccgatggggacctcgccttc
gagtatgtggacaatgacaacactgccaaccacaacatgtggctgattgggctgaagaac
atcttcagcaagcagctgcccaacatgcccaaggagtacattgcgcgattggtgctcgac
aggcgccatcgctctgtggccatcatcaggcggggaggcacggtgctgggggggataacc
taccgccccttccacgaccagcgctttggggagattgcgttctgcgctgtcacagccatc
gagcaggtgaaggggtttggagcgcggctgatgaactacacaaaggagtttgccagggcg
cacgaccacctgacgcatttcctgacctatgcggacaacaacgcggtcgggtattttgca
aagcagggcttcacaaaggagatcaccctggagaaggacaggtgggtggggttcataaag
gactacgacgggggcacgctgatggagtgcataatcagcgaccgcctgccctacacagat
ctgccgggcatgctgcgcgcgcaacgtgccgccctggaccgccacatcagaacgcttagt
aagtcccacgtcatccaccccggcctcaccaccttccgggacggccagcgccgcgtggag
atcgccagcatccccggcgtggccgaggccggctggacggctgagatggcagagccaccg
cattacaacctgctcatagaccgcatggtcctgccagtcacaccagacaacctgcagcgc
ttcatggagagggcctggagagcgctgtactctctggacgactcgtggcccttccgggag
cccgtagatgcggaggacgtcccggattactacgaaatagtcaaggacccggtggacctg
agcacgatagagcagcggctagcgaggcgggactactatgtgacgctgcacatcttcatc
gcggatgtcaaccgcatgtgcgccaacgcgcgcgtctacaactcggccgagaccatctac
ttcaagatggccaacaagctggaggccttcctggacgagtacatccactcccacgtggtc
ttcaacaacccccaggggtgcacgccaaaaaagctacccccatga

DBGET integrated database retrieval system