KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_39119Help
Entry
COCSUDRAFT_39119  CDS       T02914                                 

Definition
acyl-CoA N-acyltransferase
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     COCSUDRAFT_39119
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 395 aa AA seqDB search
MCHQFFGDEEVIKGYEDLEIDIWLSQRSFEALLEVRYSSKMQDADDIEKAMRDKFTDGLS
TTRQEYLTKLQGAAPLLLESLGKPVLEFGPERGSLAVYRDLHARLQPLLMFFVDGASFID
PEEPEWDLLLALHTDAGVVTVSGFATIYTFWCYPNQTRIRVSQVLVPPPNQGEGVGRALL
EAAYITADERGAVDITYEDPTDTVQLIRERVELQRAVKLPWLADLAASTAKALGGSPTAA
ASSNGATPPEANGAEAPVSPMLQPKDQARAQADLRITRKQVRKLWEVLLSAQPGWGEALR
QATVEGLVRARLVGGVTSTKRVAEGKRIFETEAGFHMTRVPAGSGMGPGSGMPVAMERDD
VEGESAEEREAALEEAVTKRMDELSALVAYVQRLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgtgccatcagttctttggggacgaggaggtgatcaagggctatgaggacctggagatt
gatatctggctcagccagaggagctttgaggcattgctcgaggtgcgctacagcagcaag
atgcaggatgcagacgacatcgagaaggccatgcgagacaagttcacggacggactctca
accacacgtcaggaatacctgaccaaacttcagggcgcagctccgctcctccttgaaagc
ttgggcaagccggtcctggaatttggcccagagaggggcagcctggctgtgtacagggac
ctgcatgcacgcctgcagccgctgctcatgttctttgtggacggcgccagtttcatcgac
ccggaggagccagagtgggacctgctccttgcacttcacactgatgccggcgttgtgacc
gtttcgggatttgcgactatctacaccttctggtgctacccgaaccagacgcgcatccgg
gtgtcacaagtgctcgtgccgcccccgaaccagggcgagggcgtgggcagggccctgctc
gaggccgcctacatcacagccgacgagaggggcgctgtcgatatcacgtatgaggatccc
acggacacagtgcagttgatcagggagcgcgttgagctgcagcgggcagtcaaactcccc
tggcttgctgacctggccgccagcactgccaaagccttaggtggctccccaacagccgcc
gcgagctctaacggtgccacacctcctgaggctaatggtgcagaggcacccgtctcacca
atgctacagccgaaggatcaggccagggcgcaggccgacctgcgcatcaccaggaaacag
gtgaggaagctgtgggaggtgctgctgagcgcgcagccgggctggggcgaggcgctgcgg
caggccacggtggagggcctggtgcgcgcgcgtctggtcgggggcgtcacctccaccaag
cgcgtggccgagggcaagcgcatcttcgaaaccgaggccggcttccacatgaccagggtg
ccggcagggagcgggatggggccggggtcggggatgccggtggcgatggagcgggatgac
gtggagggagagagcgccgaagagcgcgaggcagcccttgaggaagccgtgactaagcgc
atggatgagctcagcgcccttgtggcctacgtgcagcgcctgctataa

DBGET integrated database retrieval system