KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_40065Help
Entry
COCSUDRAFT_40065  CDS       T02914                                 

Definition
sterol delta-7 reductase DWF5
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    COCSUDRAFT_40065
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     COCSUDRAFT_40065
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 483 aa AA seqDB search
MVTTRAAARAQTPLGKAPPSDLSHSEPSVSTQNGKKTWAETAGAGEHIGAWGIGGTAGHV
LAYLGTLALMIGCPAFAIYMWFTLTHLDGSLVELVQFAQKAGFQGVRASWPWPSQEAWAI
IASFGGLQAFLQLALPGAVHKGPVSPKGNVPVYKANGVLAYFTTLALFVLGWQFKLFSPA
RVYDLFGEILSGLNMFSLLFCLFLYFKGKYAPSSSDSGSTGSLMYDYYWGMELYPRIGRH
FDLKTWTNCRMGMMGWGVLVLCYAVKQHELYGYLSNSMAVSILLMHLYIFKFFLWETGYW
GTMDIAHDRAGYYLCWGCLNWVPAIYTSPALYLVENPIQWSLPAATAIAVAGTLAIYINY
DSDRQRQVFRATNGKALVWGKPPQIISAKYITGDGKQKTSLLLASGWWGLARHFHYLPEI
LAAFFWTLPAGISHALPYFYVFFLTLLLTDRAFRDDVRCSSKYGAYWQQYTKAVPYKMIP
YIF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggtgaccacgagggccgctgcacgggcccagacgcccctaggcaaagcacctcccagt
gatctctcacactctgaaccctctgtttcaacgcagaatggtaaaaagacatgggcggag
actgctggggcgggcgagcatataggagcgtggggaataggaggcacagctggacacgtg
ttggcatacctgggaacgctggcgctcatgatcggatgcccagcttttgcgatatacatg
tggttcactcttacacacctggacggatccctggtggaactggtgcagtttgcccagaag
gctggcttccagggagtacgcgcctcatggccctggccatctcaggaggcctgggcaatc
attgctagttttgggggactccaggcgttccttcagctggcccttcctggtgcagtccac
aaggggccagtgtcacccaagggcaacgtccctgtctacaaggcgaatggtgtgttggca
tacttcaccacgctcgcgctctttgtcctggggtggcagttcaagcttttcagtcctgcc
agggtgtacgacctctttggcgagatcctgtcggggctgaatatgttcagcctgctcttc
tgcctgttcctgtacttcaagggcaagtatgcgcccagcagcagcgactcgggcagcacg
ggcagcctgatgtatgactactactggggcatggagctttatccgcgcatcggccgccac
tttgacctcaagacctggaccaactgccgcatgggcatgatgggctggggcgtgcttgtg
ctgtgctacgcagtcaaacagcacgagctctatggctacctctccaactccatggccgtc
tccatcctgctcatgcacctctatatcttcaagttcttcctgtgggagactggctactgg
ggcacaatggacattgcgcacgacagggcaggctactacctgtgctggggctgcctaaat
tgggtgccagccatctacacctcacccgccctctacctggtggagaaccccattcagtgg
agcctgcctgctgccacagccattgccgtggctggcaccctagccatctacatcaactat
gactctgacagacaacggcaggttttcagggcgaccaacgggaaggcgctggtgtggggc
aagcctcctcagatcatttctgccaagtacatcacaggcgacggcaagcagaagacctcc
ctgctgctggcatcaggatggtggggcctggcgagacacttccactatcttccagagatc
ttggcagcattcttctggacgctgccagctgggatctcccatgcgctgccctacttctat
gtcttctttctgacgctgctgctcacagacagggccttcagggatgatgtccggtgctcc
tccaagtatggcgcctactggcagcagtacaccaaggctgtcccctacaagatgatcccc
tacatcttctga

DBGET integrated database retrieval system