KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_43582Help
Entry
COCSUDRAFT_43582  CDS       T02914                                 

Definition
protoporphyrinogen oxidase precursor
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    COCSUDRAFT_43582
Enzymes [BR:csl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     COCSUDRAFT_43582
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 521 aa AA seqDB search
MAVSAVSTVVDRPAAFSGNVAEYEGGLQDVVVVGAGISGLTTAQALVSEHAGAVKSFLVT
EGRERVGGNITSVSGNGYLWEEGPSSFQPNDSMLKAAVDAGIGKDLVFGDPKAPRFVWWN
KKLRPTPSGPDVLTFDLLSIWGKIRAGLGAAGFKKALPEFEETVEQYVRRNLGDEVFERL
IEPFCSGVYAGDPTKLSMKAAFGKVYDLEKKGGSIIGGVLALMQEKKANPPPPRDERLPP
KPAGQTVGSFRTGLTMLPEAIAANMTDKIKLSWQLQEIEKAQDGTYNLFYQTPEGGRKVR
TRSVALTVPAYVAADLIRRDCPDASLALKSLDYPPVAAVTLAYPKSSIRQDRLDDARNLP
GFGQLHPRSQGITTLGTIYSSSLFPGRAPEGYQQLLCYIGGALNRSIVSQGDDAIFAQVD
KDLREMLIQPNAPAPQRIGIRVWPKAIPQFNLGHLDVVQGAKEDLQAAGLGGILLGGNYV
AGVALGKCVEYGYEYAKEISKYLSAQEPVAATNTEGDAFFV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggctgtatcagctgtgtcgacagtagttgatcgcccagccgcattttcaggcaatgtt
gccgagtatgagggaggcttgcaagatgtcgtggtggttggagcggggatctctggcctc
acaacggctcaagccctggtctcagagcacgcaggagcagtgaagagcttcctggtgaca
gagggcagggagcgggtgggagggaacatcacctcggtgtctgggaatgggtacctgtgg
gaggagggccccagcagcttccagcccaacgactccatgctcaaggccgcagtggatgcg
ggcattggcaaggatctggtgtttggagaccccaaggcacctcgctttgtgtggtggaac
aagaagctccggccgacgccaagcggcccggacgtgctcacatttgaccttctgtccatc
tggggcaagatccgtgccggcctcggtgccgccggcttcaaaaaggcgctgccagagttt
gaggagacagtggagcagtacgtgaggaggaatcttggggatgaggtgttcgagcggctc
atagagcccttctgctcgggcgtctatgctggcgaccccaccaagctctccatgaaggcg
gcctttggcaaggtgtacgacctggagaagaagggcgggagcatcatcgggggagttctg
gcgctgatgcaggagaagaaggccaacccgccgccgccgcgcgacgagcggctgccgccc
aagccggccggccagaccgtgggctccttccgcaccggcctcaccatgctccccgaggcc
atcgccgccaacatgacagacaaaatcaagctgagctggcagctgcaggagattgagaag
gcgcaggacggcacatacaacctcttctaccagacaccagagggcggcagaaaggtgcgc
acgcggtcagtggcgctgacggtgccggcctacgtggcagcggacctgatcaggcgcgac
tgcccagacgcgtccttggccctgaaatccctggattatccccccgtggctgctgtcacc
ctcgcctaccccaagtcctccatccgccaggaccgcctcgacgatgccaggaaccttcca
gggttcgggcagctgcacccgcgcagccagggcatcacaacgctgggcaccatctacagc
agcagcctcttccccggccgcgccccggagggttaccagcagctgctgtgctacatcggg
ggcgccctcaaccgctccatcgtgtctcagggcgacgacgccatcttcgcgcaggtggac
aaggatttgagggagatgctgatacagccgaacgcgccggcgccgcagaggatcggcatc
cgcgtgtggcccaaggccatcccccaattcaacctgggacacctcgatgtcgtccagggc
gcaaaggaggacctgcaggcagctgggctgggaggcattctgctggggggcaactatgtg
gctggtgtggctctgggcaagtgtgtggagtacggctatgagtatgccaaggagatctcc
aagtacctgtcagcacaggagcctgtcgctgccaccaatacagagggcgacgccttcttt
gtttga

  All links  
No link information was found.   
DBGET integrated database retrieval system