KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_52173Help
Entry
COCSUDRAFT_52173  CDS       T02914                                 

Definition
PEPCase 1
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    COCSUDRAFT_52173
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    COCSUDRAFT_52173
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    COCSUDRAFT_52173
Enzymes [BR:csl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     COCSUDRAFT_52173
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 959 aa AA seqDB search
MAVPSLKAPRLSLRQSLDDSLLRNTFFEIVYHHHPNLADRIDEIYKLSLAWCNSESDKDF
QALEKILSGLNPDELILVSSCFSQLLNLHNLSEEISNAQLERAVRIGEVEQSTRSTNRSF
KRLIKVNGVKPEEIYKTICEQTVELVFTAHPTQALRQSLLKKYARIRADMDSLHNKRLSP
YEKIETLESIRGQIQGAWRTDEIRRQKPSPQAEMRQGLSYFHSTIFNSLPTFYRRIDTAL
KQIGQPMLPLTHNLFNFGSWMGGDRDGNPFVTADTTRDVVITARLAAVNAFFTAIEQLMF
ELSIWRCNTEMQELAEAVHSKQAPHEQALADERKKKNFVEFWNVISLKDPFRLVLSEMRD
RLFHTREILHHCLVHTNLNLKETLENDPEAYYNKEEMVEPLLVMYNSLIETEDDSIANGR
LLDTIRQVQCFGLGMVRLDIRQESSRHNDVLDTITTYLGIGSYKAWSEEERLKWLQSELT
GKRPLLPPGMATTAEVAEVLSTFRILAELPPDSLGAYIISMAHTGSDVLAVVLLQRECGV
KQTLRVVPLFETLDDLEYSESAMEQLLSNPWYADHIKGVQECMIGYSDSGKDAGRLAAAW
GLYEVQEKLVAVADRHNVKLTLFHGRGGTVGRGGGPTHLAILSQPPGTIKGALRVTIQGE
TLEQQFGEKEVCFRTLDLYTSAVLESTLNPVVQPKAEFRSVLNEMSKTSCAAYRGVVRGD
PRFIEFFQAATPVNELGRMNIGSRPAKRKAAGSIDDLRAIPWIFAWTQTRFHLPVWLGIG
DAFQAMIDGGKLGLLQQMYKEWPFFSVTMDMIEMVFAKADPRVAQFYETGLVDKKLWPFG
EDLRKRFDQTRTLLLKVMDHKKLLETNDDVMLQQKLALRAPYITPLNILQVYCLKALRAM
ESGQGIDSAYKDYKPDDPAVQALLTRDISSAWKDPYKAAVEDTLIITMKGVSAGMQNTG
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcccctcgctcaaagcacccaggctttcccttagacaatcccttgatgattct
cttctgcggaacacgttcttcgaaattgtgtaccatcaccacccaaaccttgccgacagg
atcgacgagatatacaagctgtcgctcgcatggtgcaactcagaatcggacaaggacttt
caggctctcgagaaaatactctcggggttgaatccagacgaattgatcctggtctccagt
tgtttttcccagcttctcaacctgcacaacttatcagaggagatcagtaatgcacagctg
gagcgtgctgtccgcattggcgaggtggagcaatccacgaggtccaccaacaggtccttc
aagcggctcatcaaggtgaatggggtcaagcctgaggagatctacaagaccatctgcgag
cagaccgtggagctcgtcttcactgcgcaccccacccaggcgctgcggcagtcgctgctg
aagaagtatgcgcgcatccgggcggacatggacagcctgcacaacaagcgcctgtcgccc
tacgagaagatcgagactctggagagcattcgaggccaaatccagggcgcctggcgcacc
gacgaaatccgccgccagaaaccgtcaccccaggcggagatgaggcaggggctgtcctac
ttccactccaccatcttcaactcgctgcccaccttctaccgccgcatcgataccgccctc
aagcagatcgggcagccgatgctgccgctgacgcacaacctgttcaactttgggtcgtgg
atgggcggcgaccgcgacggcaacccatttgtgacggctgacacgacacgcgatgtagtc
atcacggcgcgcctggccgcagtaaacgcgttcttcaccgccatcgagcagctcatgttt
gagctctccatctggcgctgcaacaccgagatgcaagagctggcggaggctgtgcactcg
aagcaggcgccgcacgagcaggcgctggcggacgagcgcaagaagaagaactttgtcgag
ttctggaacgtcatctccctcaaggaccccttccgcctcgtgctgtccgagatgcgcgac
cgcctcttccacacccgcgaaatcctacaccactgcctcgtgcacaccaacctgaatttg
aaggagactctggagaatgatcctgaggcgtactacaacaaggaggagatggtggagccg
ctgctggtgatgtacaactcactcatcgagacggaggacgactccatcgccaacggccgc
ctcctcgacacaatccgccaggtgcagtgctttggtctgggcatggtgcggctggacatc
cggcaggagtcctcgcgccacaacgatgtcctcgacaccatcaccacatacctcggcatc
ggctcctataaggcgtggagcgaggaggagcggctgaagtggctgcagagcgagctgact
ggtaagcgtccgctgctgcccccgggcatggcaacaacggctgaggtggcggaggtgctc
tccaccttccgcatcctggccgagctgccgcccgactccctgggtgcctacatcatctcc
atggcccacaccggctcagacgtcctcgccgttgtcctcctgcagagggagtgcggggtg
aagcagacgctgcgggtggtgccgctgtttgagacgctggacgatttggagtacagcgag
tcggccatggagcagctgctgagcaacccatggtatgcagaccacatcaagggcgtccag
gagtgcatgatcggctactccgactccggcaaggacgccggccgcctcgccgccgcctgg
gggctctacgaagtccaggagaagctggtggcggtggcggacaggcacaacgtgaagctg
acgctgttccacggtcgcggcggcaccgtcgggcgcggcggcggccccacccacctggcc
atcctctcccagccgcccggcaccatcaagggcgccctgcgcgtcaccatccagggcgag
acgttggagcagcagtttggggagaaggaggtgtgcttccgcacgctggacctgtacacc
agcgccgtgctagagtccacactcaaccccgtcgtgcagcctaaggccgagttccgctcc
gtcctcaacgaaatgtccaagacgtcgtgcgcggcgtacaggggtgtggtgcggggggac
ccgcgcttcatcgagttctttcaggcggccacgcccgtcaacgagctgggccgcatgaac
atcggcagccgccccgccaagcgcaaggccgccggctccatcgacgacctgcgcgccatc
ccctggatcttcgcctggacccagacccgcttccacctccccgtctggctcggcatcgga
gacgcatttcaggcgatgatagacggcggcaagctgggcctgctgcagcagatgtacaag
gagtggcccttcttctccgtcaccatggacatgatcgaaatggtcttcgccaaagccgac
ccccgcgtcgcccagttctatgagacgggcctggtcgacaagaagctgtggcctttcggc
gaggacctgcggaagcgcttcgaccagacccggacgctgctgctgaaggtgatggaccac
aagaagctgctggagacgaacgatgacgtgatgctgcagcagaagctggccctgcgcgcc
ccatacatcacccccctcaacatcctccaggtgtactgcctcaaggcgctgcgcgcgatg
gaatctgggcagggcatcgacagcgcctacaaggactacaagcccgacgaccccgccgtg
caggcgctgctgacccgggacatttcgagtgcctggaaggacccctacaaggctgcagtg
gaggacaccctcatcatcaccatgaagggcgtctcagccggcatgcagaatacaggctga

DBGET integrated database retrieval system