KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_52862Help
Entry
COCSUDRAFT_52862  CDS       T02914                                 

Definition
starch branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csl00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 760 aa AA seqDB search
MRAINAETARLGLSRPVHGDLNIRKVQIPITRHCQTRKSERQRKFAILTITRASDTALEV
EAGYSKDGMDIAQLDEDLLDHEEHLKYRYNQFLQTKASLEKAEGSLANFAKGYEKMGFFR
EGNATVYREWCPAASSAQLIGDFNAWGGSWMERDAYGVWKITLPDDPQGKPAIAHGSRVK
IRLQHPGGWFVDRVPAWIRWATVEPNKMGAKYDGIFWDPPAQERHAWQHERPKDKPAALR
IYEAHVGMSSEAPEVASYTYFKDNVLPRIAKLGYNAIQLMAVQEHAYYASFGYHVTSPFA
VSSRSGTPEELKALIDEAHRLGLLVLLDVVHSHVSSNADDGIAGYDLGQGEEGNYFCSGE
RGYHTVWDSRLFNYRNWEVLRYLLSNLRWWLEEYRFDGFRFDGVTSMLYWHHGINMSFSG
DYKEYFSPATNVDAVVYLMLANVLVHELLPQAITVAEDVSGMPALGRPVSEGGCGFDYRL
GMGIPDQWMRLVKDVRDENWSMTGLVSSLCNRRYTERTVAYVESHDQSLVGDQTLAFRLM
GAEMYTGMSALQAETPGVARGMALHKIIRALTLALGGEGWLSFMGNEFGHPDWIDFPRDG
NGWSYDYCRRQWSLVDAEHLRYKYLNAWDGALQGLDSQHNFLSSTHQLVSYADDAEQVIV
AERGPLLFVFNFSPFNSYEGYKVGTPEPGRYKAVLTSDDVEFGGRGRINHDTEHFTHPEG
TPGAPETNFNDRAFSMLVASPSRTVAVYALMPEDPHESPA
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccatcaatgcagaaactgcccgcttaggtctctcaagaccggtccatggtgac
ttgaacattcgcaaggtacaaataccgatcaccaggcattgccagaccagaaaaagtgaa
aggcaacgaaaatttgcgatcttgacgataacgagagcatcagacaccgcacttgaggtt
gaagcaggatactccaaagacggcatggacattgcacagctcgatgaagaccttttggac
catgaggagcacctcaagtacaggtacaatcaattcctgcagaccaaggcctccctggaa
aaagctgagggcagccttgcaaattttgcaaaggggtacgagaagatgggcttcttccgg
gagggaaatgcgacggtgtacagggagtggtgcccggcggcctccagcgcgcagctcata
ggggacttcaacgcgtggggtggcagctggatggagcgcgatgcctatggcgtctggaag
atcaccctcccggacgatccgcagggcaagccggccatagcgcacgggtcgcgggtgaag
atccggctgcagcacccgggcggctggtttgtggaccgcgtgccggcctggatccggtgg
gccacagtggaacccaacaagatgggcgccaagtatgacggcatcttctgggaccctccc
gctcaggagcgacacgcctggcagcacgagagaccaaaggacaagcctgctgcgctgcgc
atatatgaggcccatgtgggcatgagctctgaggcgcctgaagtggcttcctacacctac
ttcaaagacaatgtgctgccgcgcattgcgaagctgggctacaatgccatccagctgatg
gcggtgcaggagcacgcatactatgcatccttcggctaccacgtgacctcgcccttcgca
gtgtcctcgcgctctggcactcccgaggagctgaaggctcttatagatgaggcgcacagg
ctggggctgctggtgttgctggatgtggtgcacagccatgtctccagcaatgccgacgat
ggcatcgcaggatatgatctggggcagggggaggagggcaactacttttgcagcggcgag
cgcgggtaccacacggtgtgggacagccgcctgttcaactaccgcaactgggaggtgctg
cgctacctgctctccaatctgcgctggtggctggaggagtacaggtttgacgggttccga
tttgacggcgtcacgtcgatgctgtactggcaccacggcatcaacatgagcttcagcggc
gactacaaagagtacttcagcccggccaccaatgtggacgccgtcgtctacctcatgctc
gccaacgtgctcgtgcatgagctcctgccacaggcgataacggtggcggaggatgtgtcg
ggaatgccggcgctggggcggccggtgagcgagggcggctgcggcttcgactaccgcctg
ggcatgggcatccccgaccagtggatgcgcctcgtcaaggatgttcgcgacgagaactgg
agcatgacggggctggtgtcctccctctgcaaccgccgctacaccgagcgcacagtcgcc
tacgttgagtcccacgaccaatccctcgtcggcgaccagaccctggcgttccggctgatg
ggcgcggagatgtacactgggatgtcggcgctgcaggcggagacgccgggggtcgcgcgc
ggcatggcgctgcacaagatcatccgcgcgctcaccctggcgctgggcggcgagggctgg
ctctccttcatgggcaacgaatttggccaccccgactggatcgacttccccagggatggc
aatgggtggagctacgactactgccgtcggcagtggagcctggtggatgcggagcacctg
cgctacaagtacctcaatgcctgggacggcgctctgcagggccttgactcccagcacaac
tttctgtcctccacacaccagctcgtgtcctacgctgacgatgcagagcaggtcatcgtg
gcggagcgggggccgctgttgtttgtgttcaacttctcgcccttcaacagctatgagggg
tacaaggtgggcactccagagccgggcaggtacaaagcagtgctgacatcagatgacgtt
gagtttggcggcagaggtcgcatcaaccacgacactgagcacttcacccaccctgaaggc
accccaggcgccccagagacaaacttcaacgaccgtgcgttctccatgctggtggcatcg
ccctctcgcaccgtggctgtgtatgcgctcatgccagaagaccctcatgagtccccggca
tga

DBGET integrated database retrieval system