KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_53099Help
Entry
COCSUDRAFT_53099  CDS       T02914                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    COCSUDRAFT_53099
   00650 Butanoate metabolism
    COCSUDRAFT_53099
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSUDRAFT_53099
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCSUDRAFT_53099
Enzymes [BR:csl01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     COCSUDRAFT_53099
Amino acid related enzymes [BR:csl01007]
 Aminotransferase (transaminase)
  Class III
   COCSUDRAFT_53099
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 474 aa AA seqDB search
MSKHALSAAVKSGAADAASLIRRHLSPAVASNSNFIAERASGSYIYSTDGQKHLDMAAGI
GVVSTGHCHPKVVKAIQEQAATLIHAQQNIFAASTPMAGLIDRLLTIAPPSLTRFFFANS
GSEAVDNAIKIARGHTGRQNIICFENSFHGRTYGSMALTTSKTYYRQGFAPLMPQVVVAP
YPYCLHCKVREAHPDGDSWYKIQPNVKPYDPYEARGCCNAPVDALKWILKQQSAPSDTAA
IIIEPIMGEGGFLAPPPNFIPALRKICDEHGILLIIDEVQAGVGRTGKWWGHQHVSGEAV
EPDIMIFAKGIASGFPFAGLATRENMFEGLASGTMGGTYGAAPLACATACATLDVIKEEK
LLDNATARGQQLVKGLLELTGKYPIIDIRGRGLMCAAEFGGRDGGMSAEPGVAAAVTKAA
GKRNMLLLTAGARETVRFLPPLTVSEGEIDEALHIFGQSLEEVFGSSAAQLKAA
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagcatgcgctaagcgcagcagtaaagtcgggggcagctgacgctgcttctttg
atccgtcggcatctcagcccagctgtcgccagcaattcgaattttatcgccgaaagggca
agcggaagctacatctacagcacagatggccagaagcacctggacatggcagcaggcatc
ggtgtggtgtcaaccggccactgccatcccaaggtggtcaaggccatccaggagcaggct
gccacgttgatccacgcgcaacagaacatcttcgctgccagcacgccaatggcgggcctg
atcgacaggctgctcacaatagcgcctcccagtctcacgcgcttcttcttcgccaacagc
ggcagcgaggcggttgacaacgcaatcaaaattgcgcgcggccacaccgggcgccagaac
atcatctgcttcgagaactcgttccacgggcgcacatatggctcgatggcgctgacaacg
tcgaagacatattaccggcaggggtttgcaccgctgatgccccaggttgtagtagcgcca
tacccctactgcctgcactgcaaagtccgcgaggcccacccggacggagactcctggtac
aagatccagccgaacgtgaagccgtatgatccgtacgaggcgcggggctgctgcaacgcg
cctgtagacgcgctcaagtggatcctgaagcagcagagcgcgccgtcagacaccgccgca
atcatcatcgagcccatcatgggcgagggcggtttccttgcgcctcctcccaacttcatc
ccggctctgcgcaagatctgcgacgagcacggcatcctgctcatcatcgacgaggtgcag
gcaggcgtgggcaggacaggcaagtggtggggccaccagcatgtgagcggagaggcagtg
gagcccgacatcatgatcttcgcgaaggggatcgcctccggctttccctttgccggcctg
gctacgcgcgagaacatgtttgagggccttgccagtggcaccatggggggcacctacggc
gctgccccgctggcgtgcgcgacggcatgtgcgacgctggacgtgatcaaggaggagaag
ctgctggacaacgccactgcgcgcggtcagcaactagtcaagggcctgctggagctgacg
ggcaagtacccgatcattgacatccgcggccgcggactcatgtgcgcggcagaattcggc
ggccgggacggaggcatgagcgccgagccgggcgtcgccgcagccgtcaccaaggctgcc
ggcaagcgcaacatgctgctgctcaccgcgggcgccagggagacggtgcggttcctgccg
cctctgacggtgagcgagggggagatcgacgaggcgctgcacatcttcggccagtccctg
gaggaggtctttggcagcagcgcagcgcagctcaaggccgcctga

DBGET integrated database retrieval system