KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_53640Help
Entry
COCSUDRAFT_53640  CDS       T02914                                 

Definition
ubiquitinyl hydrolase
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
csl  Coccomyxa subellipsoidea
Brite
Enzymes [BR:csl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     COCSUDRAFT_53640
Peptidases [BR:csl01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   COCSUDRAFT_53640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 332 aa AA seqDB search
MGDNWTTIESDPGVFTELMTEMGVQGVQMEELYALDSESLHAISPVYGLIFLFKWRSEQD
NRPAVSEADYLGKVFFAKQVITNACATQAILSVLLNRPDIQLGAELTNLKDFTADFPPEY
KGLAISNSESIRRAHNSFSPPQPIVPEESRLADKDDEVYHFISYVPVDGALYELDGLKPG
PIRLCEATEDNWLEKVGPFIQSRIERYAQSEIRFNLMAVIRNRSDVIAEELASLEDRRAA
LLSTSEEGDQMQVDGKGSETPQDLASIENEIVRVQEGLHQEAAKKKRWHDENVRRKTNYV
PFIFHFLKLLAEKGQLKPIIERAKTMPAKERQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggagacaactggacaacaatagaatcggacccaggcgtcttcacggagctgatgacg
gagatgggcgtgcaaggggtacagatggaggagctttatgctttggacagcgagtccctg
cacgcaatcagtcctgtgtatgggctcatcttcctcttcaagtggcggagcgagcaggac
aatagaccagcggtgagcgaggcagactacctgggcaaggtgttctttgcaaagcaggtg
atcaccaacgcgtgtgctacgcaagcaatactgtcggtgctcctcaacaggcccgacata
caattgggcgctgagctcaccaatctgaaggattttactgcggactttcctccagaatac
aaaggcctggcaatcagcaatagcgagagcattcggcgagcgcacaacagcttctcgccg
ccgcagccgatcgtgccggaggagagccgactggccgacaaggatgacgaggtgtaccac
ttcatctcctatgtcccagtagacggcgccctctatgagctggatggcctcaagcctggg
cccatccgcctctgtgaagccaccgaggacaactggttggagaaggtggggccattcatt
cagagcaggatcgagcggtacgcgcagagcgagatccgcttcaacctcatggcagtgatc
cgcaaccgctcggatgtcattgcagaggagctggcctctctggaggatcgcagagcggcc
cttctctccacatccgaagagggagaccagatgcaggttgacggcaaagggagcgagaca
ccgcaggatctagcctcgatagagaatgagatagtcagggtgcaagagggcctgcatcag
gaggctgcaaagaagaagcggtggcatgatgagaacgtcagaaggaagacaaattatgtg
ccgttcattttccattttctcaaactgcttgcggagaagggtcagctgaagcccatcata
gagagggccaagacaatgccagcaaaggagcgccaatga

DBGET integrated database retrieval system