KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_53746Help
Entry
COCSUDRAFT_53746  CDS       T02914                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COCSUDRAFT_53746
   00051 Fructose and mannose metabolism
    COCSUDRAFT_53746
Enzymes [BR:csl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     COCSUDRAFT_53746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 471 aa AA seqDB search
MRLTYILVALMLCTAPAWAAIQGECDSRGLYEGEFFPGVGKIPYEGPDSTNPMAFHYYNA
DEVIMGKPMKEWLRFSVAFWHTMRGDGADPFGSPTKVWPWEDASLDDMELAYRRMRAMFE
FLDKLGVDYWCFHDRDIAPEGASLAESNAMLDKVVELAEHLQKETGKKVLWGTAQLFKHP
RFMHGAATSPNASVHAYAAAQVKAAMDATLRLGGENYVFWGGREGYHTLLNTDLKLELDN
LAAFLKGAVAYKKKIGFKGALLLEPKPQEPTKHQYDWDAATTMGFLNQYGLSDEFKLNVE
CNHATLAGHSCEHELQLASAYGKLGNIDANTGDAQTGWDTDQFLTDPKEATLVAAVILKQ
GGLAPGGINFDAKLRRESTDVNDLFYGHISGMDALARGLRNAAQMLEEGILPGMIKDRYS
TYSKGVGKKIRDGKVDFVELEKVALASADPAEDLPSARAELYEIVLSRYIR
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgacatacatactcgttgcattgatgctctgcactgcacccgcatgggcggcc
attcaaggggaatgtgactcacgtggtctctacgaaggcgagtttttcccaggagttggg
aagataccttatgagggcccagactccacgaacccgatggcattccattactacaacgct
gacgaagttatcatgggaaagcccatgaaggaatggctgcgattcagcgtggctttctgg
cacacaatgcgcggggatggcgccgacccctttggatcccccaccaaggtgtggccatgg
gaagatgccagcctggacgacatggagctggcctaccgccgcatgcgcgccatgtttgag
ttcctcgacaagcttggcgttgactactggtgcttccatgacagggacatagccccggag
ggcgccagcctggcagagagcaacgccatgctggacaaggtggtggaactggcggagcac
ctgcagaaggagaccggcaagaaggtgctgtggggcaccgcgcagctcttcaagcacccc
cgcttcatgcatggagccgccacaagcccgaacgcgagcgtgcatgcgtacgctgcggcg
caagtgaaggcggcgatggatgcgacgctgcggctgggcggagaaaactatgtgttctgg
ggcggccgcgagggctaccacaccctcctcaacaccgacctcaagctggagctggacaat
ctggcggccttcctgaagggtgccgttgcgtacaagaagaagatcggcttcaagggggca
ctgctgcttgaacccaagccccaggagccaacaaagcatcagtacgactgggacgctgcc
acaacgatgggcttcctgaaccagtacggcctgtcggacgagttcaagctgaacgttgag
tgcaaccatgccaccctggccggccactcctgcgagcacgagctgcagctggcgtcggcg
tacggcaagctgggcaacatcgatgccaacacgggcgatgcgcagacgggctgggacaca
gaccagttcctgacagaccccaaggaggccaccctcgtggccgccgtcatcctcaagcag
ggcggccttgcgccaggcggcatcaacttcgacgccaagctgcggcgggagagcacggac
gtgaacgacctgttctacggccacatcagcggcatggatgcgctcgccaggggcctcagg
aacgctgcgcagatgctcgaggagggcatccttccgggaatgatcaaggaccgttacagc
acctactcaaagggggttggcaagaagatcagggatggcaaggtggactttgttgagctg
gagaaggttgctctggccagcgcggatccagcagaggatctgccgagtgcgcgggccgag
ctgtatgaaattgttctgagcagatacatcagatag

DBGET integrated database retrieval system