KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_54732Help
Entry
COCSUDRAFT_54732  CDS       T02914                                 

Definition
glutamate decarboxylase
Orthology
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    COCSUDRAFT_54732
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    COCSUDRAFT_54732
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    COCSUDRAFT_54732
   00430 Taurine and hypotaurine metabolism
    COCSUDRAFT_54732
Enzymes [BR:csl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     COCSUDRAFT_54732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 475 aa AA seqDB search
MTEPIVTNKFPEKTMPAKVVYRLIRDARELDATPRLNLASFVTTWMEPEADQLILESLNI
NYIDESEYPSTTNIQNSCVSMLADLYHAENPCGTATVGSSEAILLGGLAFKRRWQEKRKA
AGIKEAVTPNIVCSSAVHVCWEKLFNYFEIEPRYVNLTEDCFVATPEKIAAACDENTIGV
VAIMGTTYSGHFEDVAGIDAALEELNSKNGWDIKIHVDGASGAFVVPFLYPDLKWDFRCK
NVVSINASGHKYGLVYPGVGWVLFRSKEYLPDSLIFHDNYLGTDQINFTLNFSKGASQIV
AQYYQFLRLGRIGYTKIMRNCHAVAMYLGKALEDTGYFKVISARDPVPMLPLATFTLKPE
YRMNGYDEFDVADRLRQRGWVVPAYTMAPDAQAIRVLRVLCREEFSISSARTFVEDIKNA
MDWLTGHYIYTPQQLTDLKKTLGWKGTGKRAVKTTIKPGEPEVNQAAVPMHGGVC
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacggagcccatcgtgacaaacaagttccctgagaagaccatgccagcaaaggtggtg
taccgcctgatcagggacgccagggagcttgatgccaccccaaggctcaacctggcttcc
tttgtgaccacatggatggagccagaagccgaccagctcatcctggagtccctgaacatc
aactacattgatgaatcagagtacccctcaaccaccaacatccaaaacagctgcgtgagc
atgctggctgacctgtaccacgctgagaacccgtgcggaaccgccacggtcgggtcaagc
gaggcaatcctgctgggcggcctggccttcaagcggcgctggcaggagaagcgcaaggcg
gccggcatcaaggaggcagtcacccccaacatcgtctgcagctcagcagtgcatgtgtgc
tgggagaagctgttcaactactttgagattgagcctcgctacgtcaacctgacagaggac
tgctttgtggcaaccccagagaagattgcggcagcctgcgatgaaaacacaatcggcgtg
gttgctatcatgggcaccacttactctggccactttgaggacgtcgccggcatcgacgct
gctcttgaggagctgaacagcaagaacggctgggacatcaagatccacgtggatggggca
tccggggcctttgttgtgccgttcctgtacccggacctcaagtgggacttccgctgcaag
aacgtggtctccatcaacgcctctggccacaagtatggcctggtgtacccgggcgttggc
tgggttctgttccgcagcaaggagtacctgccagacagcctcatcttccacgacaactac
ctgggcactgaccagatcaacttcacgctcaacttctccaagggagcctcccagattgtc
gcacagtactaccagttcctgcggctgggccggattggctacaccaagatcatgcgcaac
tgccacgctgtcgcaatgtacctcggcaaggcgctggaggatacgggctatttcaaggtg
atatcggcgcgcgaccccgtgcccatgctgcctctcgcaacgttcaccctcaagcccgag
taccggatgaacggctacgacgagttcgacgtggccgaccgcctgcgccagcgcggctgg
gtcgtcccggcgtacaccatggcgcccgacgcgcaggcaatccgcgtgctgcgcgtgctg
tgccgcgaggagttctccatctcttctgcgcgcacttttgtggaggacatcaagaacgcc
atggactggctcacaggccactacatctacaccccccagcagctgacggacctgaagaag
actctgggctggaagggcacaggcaagcgcgcagtcaagaccaccattaaacccggcgag
ccagaggtcaaccaggcagccgtgcccatgcacggaggcgtctgctag

DBGET integrated database retrieval system