KEGG   Coccomyxa subellipsoidea: COCSUDRAFT_65542Help
Entry
COCSUDRAFT_65542  CDS       T02914                                 

Definition
UDP-Glycosyltransferase/glycogen phosphorylase
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
csl  Coccomyxa subellipsoidea
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    COCSUDRAFT_65542
   00053 Ascorbate and aldarate metabolism
    COCSUDRAFT_65542
   00500 Starch and sucrose metabolism
    COCSUDRAFT_65542
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    COCSUDRAFT_65542
Enzymes [BR:csl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     COCSUDRAFT_65542
Glycosyltransferases [BR:csl01003]
 Others
  Hydrophobic molecule
   COCSUDRAFT_65542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 563 aa AA seqDB search
MVDMAMRRAILACLCLSIVVRHAQCGTVLSVLMPGPLSHLFNMKKIAEAVAARGHTVKFL
VLDNNAHALQPTDVPVLTYSIPVVKGPFDPAAMKVKGAQNFVQTVADITRVFVSGCDGIL
SNDTLMAQLKDYNPELLLAETLSPCAQVLASKLDVPFVNFQMYAPIESVQTSAWRGSNRN
AFTPNPLAYFPQKDSGIETQHMSFPQRLHNFVAYWKFHAGDYWHVRPIVRSAFRRFGVDP
DAPKERRRMVMTMCIADFAIEWLRPLPPSYKLIGAVLPEPAQPLPADLEEFMEGAGDDGV
LLVAMGTIATLGKAEQRAMAAAFAKLPVRVLWRLSKSEVPDESAIAELKLGNNTKVATWL
PQNDVLGHPRTKAFLSHCGVNGLYEAAYHGVPIIALPFLAEQRENADKAVGRGLALRLNH
EDLLTGQFSHTITRVLTERSFKEVAEKLSVKLRARPRTPTQEAADWIEHALATHGEAYLQ
TPDQDLSLFVRLSLDVWAACLVVIALVILVAAKLARLACAKLDDALIHRVSIANSKGGAA
SYSSLPHTDGAETVINGAHVQSS
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatatggctatgaggagggcaatcctggcctgcttgtgtctgtcgattgtagtc
cggcatgcgcagtgtgggaccgtcttgtctgtgctgatgccaggcccgctcagccacctc
tttaacatgaaaaagattgcagaagcggtcgctgctcgagggcacacagtaaagttcctt
gtgctcgacaacaacgcccacgcgctgcagccgacggacgtcccggtgctcacttacagc
attcctgtcgtcaaaggaccgttcgatccagccgcaatgaaggtcaagggcgcccagaac
ttcgtccagaccgtggcagacattaccagggtctttgtgagcggctgcgatggcatcctg
tccaatgacaccctcatggctcagctgaaggactacaacccagagctgctgctggcagag
actctcagcccctgcgcacaggtcctggcgtccaagctggacgttccctttgtgaacttc
cagatgtacgccccgatcgagtcagtccagacctctgcctggcgcggcagcaaccgcaac
gcattcacccccaaccctctcgcgtacttcccccaaaaggacagcggcattgagacccag
cacatgagcttcccgcaaaggctgcacaacttcgtcgcctattggaagttccatgctggc
gattactggcatgtgcggcccatcgtgcggagcgctttccggcgatttggcgtggatccg
gacgcgccgaaggaacgccgtcggatggtcatgacgatgtgcattgcggattttgccata
gaatggctgcggccgctgccgccaagctacaagctgatcggagccgtgctgcccgagcct
gcccagccactgcccgccgatctcgaggagttcatggagggtgcaggggatgacggcgtg
ctgctcgttgccatgggcacaatagcaacactggggaaagccgagcagcgcgcgatggcg
gctgcgttcgcaaagttgccggtgcgtgtgctgtggcggctgtccaagtctgaggtgcca
gatgagtcagccatcgcagagctcaagctgggcaacaacacaaaggtggcgacgtggctg
cctcagaacgatgtgctgggccacccccgcacgaaggcgttcctgtcacactgcggtgtg
aatggactttacgaggcggcgtatcatggcgtgccaattattgcgctgcccttcttagca
gagcaacgtgagaatgccgacaaggccgtggggcggggcctggcgctgcgattgaaccac
gaggatttactgacggggcagttctcacacaccatcacgcgcgtgctgacggagcgaagc
ttcaaggaagtcgccgagaagctgtctgtgaagctgcgcgcgcggccgcggacgcccacc
caggaagctgccgactggatagagcatgcgctggccacgcacggggaggcgtacctccag
acaccggatcaggacctgtcgctgtttgtgcgcctgtccctggacgtctgggctgcatgc
ttagtcgtcatagcgttagtcatcctcgtcgcggctaaactggcgcgcctggcgtgcgcc
aaacttgacgacgcgctgattcaccgcgtcagcattgctaatagcaaggggggtgcagct
tcctacagcagcctgccgcacaccgatggcgcagaaacagtcatcaacggtgcccatgtg
cagtcgtcttag

DBGET integrated database retrieval system