KEGG   Cyanobacterium stanieri: Cyast_0058Help
Entry
Cyast_0058        CDS       T02377                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
csn  Cyanobacterium stanieri
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Cyast_0058
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Cyast_0058
Enzymes [BR:csn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Cyast_0058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(64648..66144)
Genome map
AA seq 498 aa AA seqDB search
MKLRQLLSNIEQINSIPEHPALDVDVKGVVTNSQLVSLGDVFIGMPGTRVDGGEFWQSAL
NEGAIASIISKEAYDKHPPTDSDCVIVADDMNDVCAQIASKFYDYPSQKLGMIGVTGTNG
KTTTTHLIEFFLHQAEKKTALFGTLYARWQDYQKTASHTTPFAVDLQAQLTEAVKAGNQY
AVMEVSSHALAQKRIKGCHFDVAVFTNLTQDHLDYHKDMEDYFQAKALLFNSEYLKGKAI
INYDDPYGQRLIKSVDNVWSYSVTNPEADLYTTDLVYQATGVEGILHTPQGEIKFSSPLV
GQFNLANLLAGVGAVLQLGIDLDTIAHCLPQFTGVPGRMERVQVKSDQDVTVIVDYAHTP
DSLENLLKASRPFIQGKMICVFGCGGDRDRTKRPIMGKIATDLADVVVVTSDNPRTENPT
QILEDILTGIPKHIKPIVQGDRSLAIQTAIQTAQAGDGVLIAGKGHEDYQILGTEKVHFD
DREEAQKALINNGQWTII
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacgtcaattattgtccaatatagaacagattaactctattcctgaacatccc
gcccttgatgttgatgtcaaaggggtggttactaattctcagttagtttcattgggggat
gtatttatcgggatgcccggtacaagggttgatggaggagaattttggcaaagtgctttg
aatgaaggggcgatcgcctctataatcagtaaagaagcctatgataaacacccccccaca
gactctgattgcgtcatcgttgctgatgacatgaatgatgtatgtgcgcagattgccagt
aaattttacgattatcctagtcaaaaacttggcatgataggagttacagggaccaatggc
aaaaccaccaccactcacttaatcgaatttttcctacatcaagccgagaaaaaaaccgcc
ctctttggcactctgtatgcacgttggcaagattatcaaaaaactgctagtcataccacc
cctttcgctgtggatttacaagcacaactaacggaggcggtaaaggctggtaatcaatac
gcagtaatggaagtaagttcccatgccctcgcccaaaaacgcatcaaaggttgtcatttt
gatgtggcggtatttactaatttaacccaagatcacctcgattatcataaagatatggag
gattattttcaagccaaagctctcctatttaacagcgaatatctaaaaggtaaggcgatt
attaactatgatgatccctatggacaaagattgatcaaatctgttgataatgtctggagt
tatagtgtcactaatcctgaagcggatttatacaccactgatttagtgtatcaagctacg
ggggtagaggggattttacatactccccaaggagaaattaagttttcttctcctctggtg
gggcaatttaaccttgcgaatcttttggctggggtgggtgctgtgttacagttgggtatt
gatttggataccattgctcactgcctaccccagtttacaggagtgccggggcgtatggaa
agggtacaagtaaaatcagatcaagatgttaccgttatcgtcgactatgcccataccccc
gatagcttagaaaatttactcaaagcctctcgtccttttattcagggtaaaatgatatgt
gtgtttgggtgtgggggcgatcgcgatcgcaccaagcgccctataatgggtaaaattgcc
actgatttggcggatgtggtggtagttacttctgataatccccgtaccgaaaaccccacc
caaatccttgaagatattttgacgggtattcccaagcatattaagcctattgtacagggc
gatcgctccttagccatccaaaccgccatccaaaccgcccaagcaggagatggggtatta
attgcaggaaaaggacatgaagattatcaaatattaggcacagaaaaagtgcattttgat
gatcgagaagaagcccaaaaagccctcataaacaatggacaatggacaattatttaa

DBGET integrated database retrieval system