KEGG   Cyanobacterium stanieri: Cyast_0177Help
Entry
Cyast_0177        CDS       T02377                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
csn  Cyanobacterium stanieri
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Cyast_0177
Enzymes [BR:csn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Cyast_0177
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
187883..188833
Genome map
AA seq 316 aa AA seqDB search
MQSYSLFAPAKINLHLEIIGDRPDGYHELVMIMQSVALGDVIDIRANGKEETRLFCQNPQ
VPLDNTNLAYKAVQLMQTNYPTPARNFGGLDIHIQKNIPVAAGLAGGSSNAAAVLVGINL
LWGLGLTQPELRDLATYLGSDVPFCIAGGTAIATGRGEEIEPLPDLDNIWVILAKYSNIS
VSTPWAYKTYREQFHDLYVQDSHGVSQRTHAVHSGELVRAIAHRNSKQIGALLYNDLQKS
VLPEYPEVENLINSFKKQNVLGAMMSGSGPTVFALCENEDQANEIKNIIQKQINDPNLEL
WVTKMCAHGITTIETK
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttattctctatttgcccctgctaaaattaatcttcatttagagattattggc
gatcgccccgatggctaccatgaattagtaatgattatgcaaagtgtcgccctaggagac
gttatcgacatcagagctaatggaaaagaagaaacccgacttttttgtcaaaatccccaa
gtccccctcgataacaccaatttagcctacaaagcggtgcagttgatgcaaactaattat
cctaccccagcccgaaattttggcggattggatattcacatacaaaaaaatatccccgtc
gccgctggtttggcagggggttcgagcaatgctgccgctgtattggtggggattaatctt
ttgtggggattgggtttaacccaaccagaattaagggatctagctacctatttaggctct
gatgtacccttttgtattgcgggaggaacggcgatcgccactggacggggggaagaaata
gaacccctaccagacctcgataacatctgggttatcctcgccaaatatagcaatattagc
gtatccaccccttgggcctacaaaacttatcgagaacaattccacgacctctatgtccaa
gatagccatggagtcagtcagcgcacccacgctgtacattcaggagaattggtaagggcg
atcgcccatcgtaactcaaaacaaataggagccttgttatacaacgatctccaaaaaagc
gttttgccagaatatcccgaagtagaaaatctaatcaacagtttcaaaaagcaaaacgtc
ctcggtgctatgatgtcaggatctggtcctactgttttcgccctctgtgaaaacgaagat
caagccaacgaaatcaaaaatatcatccaaaaacaaattaacgatcctaacctagaacta
tgggtaacaaaaatgtgcgcccacggtatcaccaccatcgaaactaaatag

DBGET integrated database retrieval system