KEGG   Cyanobacterium stanieri: Cyast_0259Help
Entry
Cyast_0259        CDS       T02377                                 

Definition
(GenBank) Holliday junction DNA helicase subunit RuvA
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
csn  Cyanobacterium stanieri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyast_0259
Enzymes [BR:csn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Cyast_0259
DNA repair and recombination proteins [BR:csn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Cyast_0259
    RecFOR pathway proteins
     Cyast_0259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
274936..275577
Genome map
AA seq 213 aa AA seqDB search
MINYLRGDVVSVLRSHNKRIMLVLEVNNIGYEIQIFSRFAREIEMNDIVNVQVFTHLQIR
DDQQVLYGFMSAAGRDLFRQLIGVSGIGVQSAIALIDTLGLEDLVQAIVTGNTRMLAKTP
GVGQKTAERIALELKTKLSQWRIEAGININQEKATPSPEIWADLEMTLLALGYTNDEIQQ
AVSVISQDSILLKNTMVEEWIRRAIAHLSAEIN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgattaattatcttcggggtgatgtggttagtgttcttcggagccataataagcgcatt
atgttggtgttggaggttaataatattggttatgaaattcaaattttttcccgatttgct
cgggagattgagatgaatgatattgttaatgtgcaagtttttactcatttacagattcgg
gatgatcaacaagttttatatggtttcatgtcggcggcagggagggatttatttcgacag
ttgatcggagtgtcgggtattggggtacaaagtgcgatcgcccttatcgatactttaggt
ttagaggatttagtccaggccatcgttacggggaatactcgtatgttagctaaaacccca
ggggtaggacaaaaaacggcagaaagaatagcccttgaattaaaaacaaagctatctcag
tggcgcattgaggcggggattaatataaatcaagaaaaggctactccctcccctgaaatt
tgggcagatttggaaatgactctccttgcccttggttataccaatgatgaaattcaacag
gcggtatcggtaattagtcaggatagtattttgctcaaaaataccatggtggaagaatgg
attagaagggcgatcgcccatttatcggctgaaatcaattaa

DBGET integrated database retrieval system