KEGG   Cyanobacterium stanieri: Cyast_0516Help
Entry
Cyast_0516        CDS       T02377                                 

Definition
Delta-9 acyl-phospholipid desaturase (EC:1.14.19.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
csn  Cyanobacterium stanieri
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:csn01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:csn01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
576362..577189
Genome map
AA seq 275 aa AA seqDB search
MTVSTSEKLPLAWNVIIYMATIHLVALFAFLPSNFSWGAVGLFFVLYWLTACIGITLGFH
RLVSHRSFETPKWLEYLLVLCGSLACQGGPIQWVGLHRVHHKFSDHDGDPHDSNKGFWWS
HMGWMFVQNPANQLVPKYTKDIQNDRFYQFCDKYFIPIQVALGLLLFWWGGWSFVVWGIF
LRLVVVFHVTWFVNSATHKFGYVSHDSNDHSRNCWWVAVLTFGEGWHNNHHAYQYSARHG
LQWWEVDLTWITIKTLSLFGLAKNIKLAPTTVPTK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgacagtttcaacttcagaaaaactaccactagcgtggaatgtaattatatatatggct
accattcatctagtagcactttttgcctttttacctagcaacttcagctggggcgcagtg
ggccttttcttcgttctgtactggttaaccgcctgtatcggaattactctaggatttcat
cgcttggtgtctcaccgtagctttgaaacccccaaatggcttgaatacctattagtactc
tgtggttctttagcctgtcaaggtggccctattcaatgggttggcttacatcgtgttcat
cacaaattttctgaccatgatggcgatccccatgattctaacaagggtttttggtggagt
cacatgggttggatgtttgtccaaaatccagccaatcaattagtacccaaatacaccaag
gacattcaaaatgatcgcttttatcaattttgcgataaatatttcatccccattcaagta
gcattaggtttactccttttctggtggggtggatggtctttcgtggtgtggggaatcttt
ttacgccttgtggtggttttccacgtaacttggtttgtaaatagtgctacccataaattt
ggttatgttagccacgattctaacgatcactctcgtaattgttggtgggttgcagtatta
acctttggcgaaggttggcacaacaatcatcatgcttatcaatactctgcccgtcacggt
ttacagtggtgggaagttgacttaacttggattactatcaaaacactatctttgtttggt
ttagccaagaatatcaagttagcacctaccaccgtaccaactaagtaa

DBGET integrated database retrieval system