KEGG   Cyanobacterium stanieri: Cyast_0839Help
Entry
Cyast_0839        CDS       T02377                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
csn01100  Metabolic pathways
csn01110  Biosynthesis of secondary metabolites
csn01130  Biosynthesis of antibiotics
csn01230  Biosynthesis of amino acids
Module
csn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyast_0839
Enzymes [BR:csn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Cyast_0839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS ThiG NanE
Motif
Other DBs
NCBI-ProteinID: AFZ46811
UniProt: K9YIN1
Position
938628..939509
Genome map
AA seq 293 aa AA seqDB search
MRIRRQEPSPAVAVESLRYQVKVPEAEPKNILEEIVWYKEQEVGKMRDRLSLLDLRVKVN
NLTNQPKDFLGALRNSPNQPALIAEVKKASPSKGVIRADFDPGAIATAYEKGGAACLSVL
TDKKFFQGSFENLTIVRNTVNLPLLCKEFVIYPYQIYLARLNGADAVLLITAILKDSDIK
YFLKIIEGLGMTALIEVHTLQELDRVLAIDGVKLIGINNRNLEDFTVTLDTTKDILAQRA
DIIKEKDITIVSESGLYTKDDLEFVQQAGANAVLIGESLVKQDDITSAVQNLY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagaatccgtcgccaagagccttcccctgccgttgccgttgagagtttacgctatcag
gtaaaagtaccagaagccgagccaaaaaacatccttgaggaaattgtctggtacaaagag
caagaagtaggaaaaatgcgcgatcgcctttctctgttagatttgagagtaaaggtaaac
aatcttaccaaccaacccaaagactttttaggggcgctacgtaatagccctaatcaaccc
gccctcattgcagaagtaaaaaaagcatcccccagtaaaggggttattcgtgctgatttt
gatccaggtgcgatcgccactgcctatgaaaaaggaggtgcggcttgtttatccgtatta
accgacaaaaaattctttcaaggtagttttgaaaaccttaccattgtcagaaataccgtc
aatttacccctattgtgcaaagaatttgtcatttacccctatcaaatatacctcgctagg
ctcaacggtgccgatgccgtcttactcatcaccgccattctcaaagatagcgacatcaaa
tatttcctgaaaattattgaaggattgggcatgacagccttaatagaagttcacaccctc
caagaattagatcgagtattagccatcgatggagtaaaactaatcggtatcaacaaccgt
aacctcgaagacttcaccgttaccctcgacaccaccaaagacattctcgcccaacgcgca
gacatcatcaaggaaaaagatataaccatcgtcagcgaatcaggtttatataccaaagac
gacttagaatttgtacaacaagcaggggctaatgcagttttaatcggtgaatccttggtt
aaacaagacgacatcacttctgctgtgcaaaatctgtattag

DBGET integrated database retrieval system