KEGG   Cyanobacterium stanieri: Cyast_0899Help
Entry
Cyast_0899        CDS       T02377                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
csn  Cyanobacterium stanieri
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cyast_0899
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_0899
   00620 Pyruvate metabolism
    Cyast_0899
   00650 Butanoate metabolism
    Cyast_0899
  Lipid metabolism
   00071 Fatty acid degradation
    Cyast_0899
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cyast_0899
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyast_0899
   00626 Naphthalene degradation
    Cyast_0899
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cyast_0899
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Cyast_0899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001353..1003944
Genome map
AA seq 863 aa AA seqDB search
MTDNQQQLMQLEELISKVKQAQKIYANFSQEQVDRIFKRAALAANDARIPLAKSACEETG
MGIVEDKVIKNHFASEIIYNKYRDEKTCGVIEKDEFYGIEKVAEPIGLIAGIIPTTNPTS
TAVFKILLALKTRNGIILSPHPRAKKCTVEATKVILEAAIAAGAPPDIIGCIEEPTLQVS
QALMQHPEIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAFVAGSADIKMAVSSIMLSK
TFDNGMICASEQSVIVENEIYDEFRKEFEFRGAYFTTPEETKKLRQVILKDGRLNADIVG
QSVIQIAELANIVIPPESKVLIAEVEEIGINEPLSYEKLSPILAMYRARDLEDGTAKAAR
LVEFGGRGHTSVIYIAQDDHEHIEYFEARMETSRVLVNTPASMGAIGDLYNFRLDPSLTL
GCGSWGGNSISGNVGVSHLLNVKTITERRENMLWFRVPPKVYFKYGCLPVALGDLAGKHR
AFIVTDRPLYDLGITSKIESVLEQLGIKYDIFYDVEPDPSLSTVNRGLDRMNSFNPDVII
AVGGGSPMDAAKIMWLLYEHPDIEFEGIATRFMDIRKRVYDLPPLGEKAIMVAIPTTSGT
GSEVTPFAVVTDDRTGVKYPLADYALTPNIAIVDPELVLNMPKGLTAFGGIDALTHALEA
YVSAYSTEFTSGLALKAIGLIFEYLPRSYREGAKDVKAREKVHYAATIAGMAFANGFLGI
CHSLAHKLGSRFHIAHGLANALMISHVIRYNATDAPFKQAIFSQYKYPNAKYRYAQIADY
LHLGGETEEEKVELLIEAVETLKRAVNIPATIKEVYSGTEEEFLGAIATLAEEAFDDQCT
GSNPRYPLIKDMKDLYITAYHGY
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atgacagataatcaacaacaattaatgcaattagaagaattaataagtaaggtaaaacaa
gctcaaaaaatttatgctaactttagccaagaacaagtagatcgtatttttaaacgggcg
gctttagcggctaatgatgcccgtattcctctcgcaaaatctgcttgtgaagaaacaggc
atgggtatagtggaagataaagtaataaaaaatcacttcgcttcagaaattatttacaac
aaatatcgtgatgaaaaaacctgtggagttattgaaaaagacgagttttatggcatagaa
aaagtagccgaacccattggtttaattgcaggaattattcccaccactaaccccacctcc
accgctgtttttaaaattcttttagccctcaaaactcgcaatggaattattttatctccc
catccaagggcgaaaaaatgtaccgtagaagccactaaagttatcttggaagctgcgatc
gcagcgggggcccctcctgatattattggttgtatagaagagcctactttacaagtttct
caggcattgatgcaacaccccgaaattaaattaatccttgccacaggggggccagggatg
gtaaaagctgcttactcctctggacatccttcccttggggtgggtgctggtaatacccct
gcttttgtggcgggtagtgcggatataaaaatggctgtttcttcgattatgctcagtaaa
acctttgataatggcatgatttgtgcctctgagcagtcggtaatcgtggaaaatgagatt
tatgacgagtttaggaaagaatttgagtttaggggagcttattttactaccccagaggag
acgaaaaaattacggcaggttattctcaaagatggtcgtcttaatgccgatattgtaggg
cagtcggtgatccaaattgccgagttggcaaatattgtcattcccccagagagcaaggta
ttaattgctgaggtggaggaaattggcattaatgagcctttatcctatgaaaaattatcc
cccattcttgccatgtatcgagccagagatttggaagatggcacagctaaagctgctcgg
ttagtggaatttggtggtaggggtcatacttcggtgatttatatcgctcaggatgaccat
gagcatatagaatattttgaggcacgaatggaaaccagtcgggtgttggtgaatactcct
gcgtccatgggtgccatcggggatttatataatttccgcctcgatccttctcttaccctt
ggttgtggtagttggggggggaactccatcagtggtaatgtgggggtatctcacctgttg
aatgtgaaaaccattaccgagcgtagggaaaacatgctctggtttagggtaccgccgaag
gtatattttaaatacggttgtttgcccgtggctttgggagatttggcaggaaaacatcga
gcttttattgtaaccgatcgccccttatacgatcttggcattactagcaaaatcgagagc
gtattggaacagttgggcatcaaatatgatatattctatgacgtagaaccagatcccagt
ttaagcaccgtaaaccgtggtttggatcgcatgaacagctttaaccccgatgtaatcatt
gctgtggggggtggttcacccatggatgccgccaaaatcatgtggttattgtacgaacat
cccgacatcgaatttgaaggcattgccacccgttttatggacattcgcaaacgggtatat
gatctccctcccttgggggaaaaagccatcatggtggccattcccaccacctctggcacg
ggttcggaagtaactccctttgccgtggtaacggacgatcgcactggggtaaaatatcct
ttagcagactacgccctaacccccaatatcgccatagttgaccccgaattggtattaaat
atgcccaagggtttaacagcttttgggggtatagatgccctcacccacgccctagaagcc
tacgtttccgcctattctaccgagtttaccagtggtttggctctaaaggcgatcggtttg
atctttgaatatctccctcgctcctaccgtgaaggggcaaaagacgttaaggcaagggaa
aaagtccactatgccgccaccattgcggggatggccttcgctaacggtttccttggtatc
tgccattccttggctcacaaattgggttctcgcttccatattgcccatggtttggctaat
gccctgatgatttcccatgtaattcgttacaatgccaccgatgccccttttaaacaggcg
atcttttctcagtacaaatatcctaatgctaaataccgttatgcccaaattgctgactat
ctccatctagggggtgaaacggaggaggaaaaagtggagttactcattgaggcggtggaa
actctcaaacgggcggttaatattcctgccaccattaaagaagtgtactctggcactgaa
gaggaatttttaggggcgatcgccactttagccgaggaagcctttgatgatcaatgtaca
ggtagcaatccccgttatcctttgatcaaagacatgaaggatttatatatcactgcctac
catggttattaa

DBGET integrated database retrieval system