KEGG   Cyanobacterium stanieri: Cyast_0911Help
Entry
Cyast_0911        CDS       T02377                                 

Definition
cobaltochelatase (EC:6.6.1.2)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
csn  Cyanobacterium stanieri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:csn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1016805..1020830
Genome map
AA seq 1341 aa AA seqDB search
MFTNVKSAIRHIAPEDLQGRALMKVVYVVLEPQYQSSISAAIKSINAHNPNLAIEISGYL
IEELRSPENYEEFKKDVAEANIFIASLIFIEELAQKVVEAVTPHRDHLDAAVVFPSMPEV
MRLNKMGSFSMAQLGQSKSVIGDFMKKRKQKSGAGFEDAMLKLLRTLPTVLKYLPVEKAQ
DARNFMLSFQYWLGGSADNLENFFLMLADKYVFTGEKSLLNRNAEYAEPVVYPDMGIWHP
LAPKMFEDVKGYLNWYNSRDDIGDDLRDPLAPTIGLVLQRTHLVTGDDAHYVAMLQELEY
RGARVIPIFAGGLDFSKPVDEYFWDKPVQGVEPLPIVDAVVSLTGFALVGGPARQDHPKA
VESLKRLNRPYMVALPLVFQTTEEWEESDLGLHPIQVALQIAIPELDGAIEPIILSGRDG
NTGRSITLQDRVEAIASRALKWTNLRKKPKLDKKLAITVFSFPPDKGNVGTAAYLDVFGS
IHEVLKGMQQNGYDIQDVPETPKELMEMVIHDAQAQYSSPELNVAYRMSVEEYERLTPYS
QKLEENWGPPPGHLNSDGQNLLIYGKHFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGF
AAYYTYLEKVWGVDAVLHFGTHGSLEFMPGKQMGMSGDCYPDSLIGNIPNIYYYAANNPS
EATIAKRRSYANTISYLTPPAENAGLYKGLEELSELIGSYQGLKEGGRAVQIVNTIVDKA
RICNLDKDIPEIATPEGQEADLFDSSTMSQDERDTIVGAVYRKLMEIESRLLPCGLHVIG
KPPTAEEAIATLVNIGSLDREEDGIWSLPTIIARSIGRNMEEIYRNADKGVLADVELLQH
ITEATRAAVRALVEEQVNAEGRVSFVSKLNFFNMGKKEPWVAQLHEFGYTNVDEKAIKPL
FEYLEFCLEQVCADNELGGLLKALEGEYVLPGPGGDPIRNPNVLPTGKNIHALDPQKIPT
LAAVQSAKIVVDRLLERQKIDNGGKYPETIACVLWGTDNIKTYGESLAQIMWMIGVKPVP
DALGRVNKLELIPLEELGRPRIDVVVNCSGVFRDLFINQMNLLDQAVKKAAEADEPIEMN
FVRKHALDQAEEMGINLRQAATRVFSNASGSYSSNVNLAVENSSWEEEQELRDMYLNRKS
FAFNSDNPGVMDESRDIFEKSLKTADATFQNLDSSEISLTDVSHYFDSDPTKVVASLRDD
GKKPSAYIADTTTANAQVRTLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNT
MGWSATADAVDNWVYEDTNTTFIQDEEMCKRLMDLNPNSFRRMVSTLLEVNGRGYWETSD
ENIEKLQQLYQEAEDRIEGIE
NT seq 4026 nt NT seq  +upstreamnt  +downstreamnt
atgtttacaaacgtaaaatccgccatcagacatatagcacccgaagatttacaaggtcgt
gctttaatgaaggtggtttatgttgttttagaacctcaatatcaaagttccatttcagcg
gcaatcaaatccattaacgcccataatcctaatctcgccatcgaaattagtggttatctc
attgaggaattgagaagccctgaaaactacgaagaatttaaaaaagatgttgccgaagca
aacattttcattgcctctttgatcttcattgaagaattggcccaaaaagtggtagaagcc
gttaccccccatcgtgatcacctcgatgcagcggtcgtcttcccctccatgcccgaagta
atgcgcctcaataaaatgggtagctttagcatggcacaactagggcaaagtaagagcgtt
atcggcgacttcatgaaaaagcgtaagcaaaagtcaggggctggttttgaagatgccatg
ctcaaacttttacgcaccctccccacggtattaaaatatttacccgtggaaaaagcccaa
gatgctcgtaactttatgttaagtttccagtattggttaggaggttcggcggacaactta
gaaaatttcttcttgatgttggctgacaaatatgttttcaccggggaaaaatccttactc
aaccgtaacgctgagtatgcagaacccgtagtatatcctgacatgggtatttggcatccc
ctcgctcccaaaatgtttgaagatgttaagggttatcttaattggtataacagccgggat
gacattggtgatgatttaagagatccccttgctcccaccattggcttagtattacaacgt
acccacctagtcacaggggatgatgcccattatgtggcgatgttacaggagttggaatat
cgtggagctagagttattcctatttttgctggtggtttagacttttctaaacctgtggat
gagtatttttgggataaacctgtccaaggagttgaacctttacccatcgtagatgcagtg
gtttccctcactggttttgcccttgtgggagggcctgctagacaggatcatcccaaggcg
gtggaatctttaaaacgtctcaatcgcccctatatggtggctttacccctcgtgttccaa
accacggaggaatgggaagaaagtgatctcggtttacaccccatccaggtagcgctgcag
attgctattcctgagttagatggtgccattgagccgattattctttctggtagggatggt
aatactggacgttctattactttacaggatcgggtagaggcgatcgcctccagggcctta
aaatggactaacctacgtaaaaaacccaaattagacaaaaaacttgccattaccgtcttc
agtttcccccccgataaaggaaacgtgggaaccgccgcttatttagacgtattcggctcc
atccacgaagtgttgaagggaatgcaacaaaacggctacgacatccaagacgtacccgaa
acccccaaagaattgatggaaatggtcatccatgacgctcaggcacaatattctagccct
gagttaaacgtggcttaccgcatgagcgtagaagaatacgagcgtttaaccccctactct
caaaaacttgaggaaaactggggcccaccccccggacatctcaacagcgatggtcaaaac
cttttaatttacggtaaacactttggtaacgtatttattggggttcaacccaccttcggt
tatgaaggagatcccatgagactcctattttctcgctctgcttcccctcaccatggtttt
gcagcttactatacctaccttgaaaaagtttggggtgtggatgcggtactccatttcgga
acccatggctccctcgaattcatgcccggtaaacagatggggatgtctggagactgttac
cccgatagtctcatcggtaatattcccaatatctattactacgccgccaataaccccagt
gaggcaaccatcgctaaacgtcgtagttatgccaacaccatttcttacctcacccctcct
gccgaaaacgctggattatacaaaggtttggaagaattgagcgagttaattggttcttac
caaggtttaaaagaaggtggtcgtgcggtgcaaatcgttaataccattgtggataaagcc
cgtatttgtaacctcgataaagatattcctgaaattgctactcccgaagggcaggaagct
gatttattcgactctagcaccatgtctcaggatgaaagagataccattgttggggcggta
tatcgtaagttgatggaaattgaatcccgtcttttaccctgtggattacacgtcattggt
aaacctcctaccgctgaagaggcgatcgccactttggtgaacattggtagcttagatcgt
gaagaagacggtatctggagtttacccaccatcatcgccagaagcatcgggcgtaacatg
gaagaaatttatcgcaacgccgataaaggggtactcgccgatgtagaactattacaacac
atcaccgaagccaccagagccgctgtcagagccttagtcgaagaacaagtgaacgctgaa
ggcagagtttcctttgtgtccaaacttaacttcttcaacatgggcaaaaaagagccttgg
gttgcccaactccatgaatttggttacaccaatgtggacgaaaaagccatcaaacccttg
tttgaatatctcgaattttgccttgagcaagtttgcgccgacaacgaattaggcggacta
ctcaaagcccttgagggtgaatatgtactacccggaccaggaggagatcctatccgtaac
cccaatgtattacccacagggaaaaacattcacgccctcgatcctcaaaaaatccccacc
ctagccgcagtacaatcagctaaaatcgtggtggacagactcctagagcgtcaaaagatt
gacaacggcgggaaataccccgaaaccatcgcctgtgtattatggggaaccgataacatc
aaaacctatggagaatccctcgctcaaatcatgtggatgattggggtgaaacctgtaccc
gatgccttgggaagggtaaataaactcgaattaattcccctcgaggaattaggcagaccc
cgtattgatgtagtggtaaactgttctggggtattccgtgatctattcatcaaccaaatg
aatcttttagatcaagcggtaaaaaaagcagcggaagccgatgaacccatcgagatgaac
tttgtacgcaaacacgctttagatcaagcagaagaaatgggtattaacctccgtcaggcg
gcaacccgtgtcttctccaatgcttctggttcatactcttctaacgttaacttagcagtg
gaaaacagtagttgggaagaagagcaagaattacgggatatgtacttaaaccgtaaatcc
ttcgccttcaactccgataatccgggggtaatggatgaaagcagagacattttcgagaaa
tccttgaaaaccgccgatgctactttccaaaacctagactcctccgagattagcttaacc
gatgtatcccactacttcgactctgatcctaccaaggtagtagcatccttacgggatgat
ggtaaaaaaccctctgcctacatcgcagacaccaccaccgccaacgcccaggtgcgtacc
ctatctgaaaccgtgcgccttgatgcccgtaccaaactattaaaccccaaatggtacgaa
gggatgttatcccacggttatgaaggggtaagggaattatccaaacgccttgtaaatacc
atgggttggagtgccaccgccgacgctgtggacaactgggtatatgaggatactaatacc
acctttatccaagatgaagagatgtgtaagcgtttaatggatttaaaccccaactctttc
cgtcgtatggttagcaccttattggaagttaacggacgtggttattgggaaacctctgac
gagaatatcgagaagttacaacagttataccaagaagcagaagatcgcattgaaggcatt
gaataa

DBGET integrated database retrieval system