KEGG   Cyanobacterium stanieri: Cyast_0945Help
Entry
Cyast_0945        CDS       T02377                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
csn  Cyanobacterium stanieri
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:csn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Cyast_0945
DNA repair and recombination proteins [BR:csn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Cyast_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057186..1057833
Genome map
AA seq 215 aa AA seqDB search
MTEYCTLEWIFVTEINHIYTPPLARLIEQLQKLPGVGPKSAQRLALHILKRPDKDAENLA
QAILDAKRRVGFCQRCFHLSAEPICNICSNPNRDEKVICVVADSKDVIALEKTREYQGKY
HVLGGVISPMDGIGPEQLNITALVERVSREKTEEVILAINPSVEGETTTLYIGQLLKPFT
RVTRIAFGLPMGGDLEYADEVTLARALEGRREIDD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatattgtacactagagtggattttcgttacggagataaatcatatttatacc
ccaccccttgcccgtttaattgaacaattgcaaaagttacctggtgttggtccaaaaagt
gctcaaaggttggctttacatattctcaaacgtcctgataaggatgcggaaaatttagcc
caagcaattttagatgctaaaagacgggttggtttttgtcagcgatgttttcatctttcc
gctgaacccatttgtaatatatgtagtaatcctaatcgagatgaaaaagtgatctgtgtg
gtggcggattctaaggatgtgattgccctcgaaaaaacaagggagtatcagggtaaatat
catgtgttggggggggttatttcaccgatggatggcattgggcctgagcaactaaatatt
acggcgctggtggaaagggtaagtcgggagaagacggaggaggttattttggcgataaat
cctagtgtggagggggaaacgactacgctttatattgggcagttgctcaagccttttaca
agggtgactcgtattgcctttggtttacccatgggaggggatttggaatatgctgatgag
gtgactttggcccgtgctttggaagggcgcagggaaattgacgattga

DBGET integrated database retrieval system