KEGG   Cyanobacterium stanieri: Cyast_0945Help
Entry
Cyast_0945        CDS       T02377                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
csn  Cyanobacterium stanieri
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:csn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1057186..1057833
Genome map
AA seq 215 aa AA seqDB search
MTEYCTLEWIFVTEINHIYTPPLARLIEQLQKLPGVGPKSAQRLALHILKRPDKDAENLA
QAILDAKRRVGFCQRCFHLSAEPICNICSNPNRDEKVICVVADSKDVIALEKTREYQGKY
HVLGGVISPMDGIGPEQLNITALVERVSREKTEEVILAINPSVEGETTTLYIGQLLKPFT
RVTRIAFGLPMGGDLEYADEVTLARALEGRREIDD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatattgtacactagagtggattttcgttacggagataaatcatatttatacc
ccaccccttgcccgtttaattgaacaattgcaaaagttacctggtgttggtccaaaaagt
gctcaaaggttggctttacatattctcaaacgtcctgataaggatgcggaaaatttagcc
caagcaattttagatgctaaaagacgggttggtttttgtcagcgatgttttcatctttcc
gctgaacccatttgtaatatatgtagtaatcctaatcgagatgaaaaagtgatctgtgtg
gtggcggattctaaggatgtgattgccctcgaaaaaacaagggagtatcagggtaaatat
catgtgttggggggggttatttcaccgatggatggcattgggcctgagcaactaaatatt
acggcgctggtggaaagggtaagtcgggagaagacggaggaggttattttggcgataaat
cctagtgtggagggggaaacgactacgctttatattgggcagttgctcaagccttttaca
agggtgactcgtattgcctttggtttacccatgggaggggatttggaatatgctgatgag
gtgactttggcccgtgctttggaagggcgcagggaaattgacgattga

DBGET integrated database retrieval system