KEGG   Cyanobacterium stanieri: Cyast_0985Help
Entry
Cyast_0985        CDS       T02377                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
csn  Cyanobacterium stanieri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyast_0985
Enzymes [BR:csn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyast_0985
Exosome [BR:csn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyast_0985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093332..1095611
Genome map
AA seq 759 aa AA seqDB search
MPSNITSQQVEQIVNNLHHDPFEILGIHLLSEQEEQKTYVIRAYLPKASEAYVIAPELRQ
EYKMRSHHHPNFFECEIETEELNNYQLKVKQGDQEKVIYDPYQFKSHKITDYDLYLFQEG
NHHRIYEKLGAHVMEQNGVKGVYFAVWAPNARNVSVLGDFNSWDGREHQMRKINNIVWEL
FIPELDYGTHYKYEIKNWEGHIYEKSDPFGFYQEVRPKTASIVADLDSYQWHDQEWLEKR
RNTDPLTQPISVYELHIGSWLHTSKEQLPKNYGIQTEVVTASEVKPDARFLTYYELAESL
IPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRYGSPEDLMYFIDQCHQNDIGV
IVDWVPGHFPKDGHGLAFFDGTHLFEHGDPRKGEHKGWGTLVFNYGRNEVRNFLVANALF
WFDKYHIDGIRVDAVASMLYLDYDRENGEWVANDYGGRENIEAVEFLRQVNGTIFGYFPG
ILSIAEESTSWAMVSRPPYMGGLGFNMKWNMGWMHDMLDYFAMDPWFRQFHQNSVTFSMW
YHHSENYMLALSHDEIVHGKSNMIGKVPGDEWQKFANLRSLFTYMFAHPGKKTMFMSMEF
GQWTEWNVWKDLEWHLLNYQSHRQFKGFFTNLNDIYKSQPALYENDFEEEGFQWIDCSDN
RHSVVSFIRRAKDPQEFIVVVCNFTPQPHSHYRVGVPEAGFYSEIFNSDSKDYGGSNMGN
LGGKWTDEWFFHDYPYSLDLCLPPLGVLMLKLDRDKAID
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgcctagcaatattaccagtcaacaagttgaacaaatcgttaataatttacaccatgat
ccctttgaaattttagggattcatcttctttccgaacaagaagaacaaaaaacctacgtc
atcagagcctatttacccaaagcctccgaggcttatgtcattgctccagagctaagacaa
gaatataagatgcgatcgcaccatcaccccaacttttttgaatgtgaaatcgaaacagaa
gaactcaacaactaccaactaaaagtaaaacaaggggatcaagaaaaagtaatctatgac
ccctaccaattcaaatcccacaaaatcaccgactacgacttatacctcttccaagaaggc
aaccatcaccgcatctacgaaaaactaggcgcccacgtcatggaacaaaacggcgtcaaa
ggagtttacttcgccgtctgggctcccaacgccagaaacgtatccgtcctcggagacttc
aacagttgggatggtagggaacatcaaatgcgcaaaatcaataatatcgtctgggaacta
tttattcccgaactagactacggcacccattacaaatacgaaatcaaaaactgggaagga
catatttacgaaaaatcagatcccttcggcttttaccaagaagtccgaccaaaaaccgcc
tccatcgttgccgacttagactcctatcaatggcatgaccaagaatggctcgaaaaaaga
cgtaacaccgatcccctcacccaacccatctccgtttatgaacttcatatcggttcatgg
ttacacacctccaaagaacaattacccaaaaattacggcatccaaaccgaagtcgtcacc
gcctccgaagttaaacccgatgcccgtttcctcacctactacgaactagccgaaagcctc
atcccctacgtaaaagaactaggatacacccacatcgaactcctacccatcgccgaacac
ccctttgatggttcatggggttatcaagtaacaggatactatgcccccacctcccgttac
ggttcccccgaagatttgatgtactttattgatcaatgtcaccaaaacgacatcggcgta
atcgtcgattgggtacccggccacttccccaaagatggacatggactcgccttttttgat
ggtacccatttatttgaacatggagatcctagaaaaggagaacataaaggctggggtaca
ttagtatttaactatggtcgtaatgaagttcgtaacttcctcgtcgctaatgccctattt
tggttcgataaataccacattgatggcattcgagtagatgcggtcgcttccatgctatac
ctcgactatgaccgagaaaatggggaatgggtagccaatgattatggtggtagggaaaac
atcgaagccgtagaatttttaagacaagtaaacgggactatcttcggttacttccccggt
atcctttccatcgccgaagaatcaacttcctgggccatggtatctcgtcccccttatatg
ggtggtttagggtttaatatgaagtggaatatgggctggatgcacgatatgctcgactat
ttcgccatggatccttggttccgtcaattccatcaaaatagcgtcacctttagtatgtgg
tatcatcacagcgaaaactatatgttagccctttcccacgatgaaatcgtccacggcaaa
agtaacatgataggtaaagtaccgggagatgaatggcaaaaattcgccaatttgcgcagt
ttgtttacttatatgtttgcgcatccgggtaagaaaaccatgtttatgagtatggagttt
gggcagtggacagaatggaatgtctggaaggatttagaatggcatctgttaaattatcaa
tcccatcggcagtttaaaggtttctttaccaacctcaatgacatttataaatcccaacct
gccctctatgagaatgattttgaggaggaaggtttccagtggattgattgtagtgataat
cgtcatagcgttgtttcctttattcgccgtgccaaagatccccaagaatttatcgttgta
gtgtgtaattttactccccaaccccatagccattatcgagtaggagtccccgaagctgga
ttttatagcgaaatatttaatagcgactctaaagattatggaggtagtaatatgggtaat
ttaggcggaaaatggaccgatgaatggtttttccatgattatccctactctctcgattta
tgtttacctcccctcggtgttttaatgctcaaattagatcgtgataaagctatagattga

DBGET integrated database retrieval system