KEGG   Cyanobacterium stanieri: Cyast_1031Help
Entry
Cyast_1031        CDS       T02377                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
csn  Cyanobacterium stanieri
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:csn00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143567..1144133
Genome map
AA seq 188 aa AA seqDB search
MTSLKIFDENNPTVPIFDSQEVTNHREKMDKIVYHLNQVGVKFEQWQTKNEIRLGATQED
VLKAYDGDVQRLIQEAGYQAVDVVSLTSDNPQKDAFREKFLNEHTHSEDEVRFFVAGEGL
FSLHLDNRVFEVLCTKGDLISVPANTPHWFDMGPNPNFIAIRLFNNPEGWVANFTGSDIA
SKFSRLEN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgactagcttaaagatatttgatgaaaataaccccacagtgccaatttttgatagccaa
gaggttactaatcacagggagaaaatggataaaattgtttatcatctcaaccaagtgggg
gtaaagtttgaacagtggcaaacgaagaatgagattcggttaggggctacccaagaggat
gttttgaaagcctatgatggcgatgtgcaaagattaatccaagaggctggttatcaggcg
gtggatgtggttagtttaaccagtgataatccccagaaggatgcttttcgggaaaagttt
ttaaatgagcatacccatagtgaggatgaggtgcgcttttttgtggcgggagagggttta
tttagtttgcaccttgataatagggtgtttgaggtattatgcactaagggagatttaatt
agtgtacctgctaatactccccattggtttgatatgggccctaatcctaattttattgct
attcgtctttttaataatcctgaaggatgggtggctaattttactggttcagatattgcc
tcaaagttttcccgtcttgaaaattaa

DBGET integrated database retrieval system