KEGG   Cyanobacterium stanieri: Cyast_1031Help
Entry
Cyast_1031        CDS       T02377                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
csn  Cyanobacterium stanieri
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Cyast_1031
Enzymes [BR:csn01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Cyast_1031
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Cyast_1031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1143567..1144133
Genome map
AA seq 188 aa AA seqDB search
MTSLKIFDENNPTVPIFDSQEVTNHREKMDKIVYHLNQVGVKFEQWQTKNEIRLGATQED
VLKAYDGDVQRLIQEAGYQAVDVVSLTSDNPQKDAFREKFLNEHTHSEDEVRFFVAGEGL
FSLHLDNRVFEVLCTKGDLISVPANTPHWFDMGPNPNFIAIRLFNNPEGWVANFTGSDIA
SKFSRLEN
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgactagcttaaagatatttgatgaaaataaccccacagtgccaatttttgatagccaa
gaggttactaatcacagggagaaaatggataaaattgtttatcatctcaaccaagtgggg
gtaaagtttgaacagtggcaaacgaagaatgagattcggttaggggctacccaagaggat
gttttgaaagcctatgatggcgatgtgcaaagattaatccaagaggctggttatcaggcg
gtggatgtggttagtttaaccagtgataatccccagaaggatgcttttcgggaaaagttt
ttaaatgagcatacccatagtgaggatgaggtgcgcttttttgtggcgggagagggttta
tttagtttgcaccttgataatagggtgtttgaggtattatgcactaagggagatttaatt
agtgtacctgctaatactccccattggtttgatatgggccctaatcctaattttattgct
attcgtctttttaataatcctgaaggatgggtggctaattttactggttcagatattgcc
tcaaagttttcccgtcttgaaaattaa

DBGET integrated database retrieval system