KEGG   Cyanobacterium stanieri: Cyast_1283Help
Entry
Cyast_1283        CDS       T02377                                 

Definition
protoporphyrin IX magnesium-chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
csn  Cyanobacterium stanieri
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:csn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1411694..1412767
Genome map
AA seq 357 aa AA seqDB search
MTTTLQAPPKKNRRLVFPFTAIVGQEQMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRA
LADLLPEISVVAGDPFNSDPNDMEMMGEELREKIEQNQHIDTVQKKVPMIDLPLGATEDR
VCGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVER
EGISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKDPDLRVQIVEQRAEFDQD
PQGFLAKYEDDQRALQQKLVDAQNLLPQITIDYEIRVKVSEICSDLDVDGLRGDIVTNRA
AKAIAAFEGRTEVTVDDIRRVMPLCLRHRLRKDPLESIDSGYKVEKAVDRVFGLEVE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccactttacaagcacctcctaaaaaaaatcgtcgtttagtttttccttttact
gccattgttggacaagagcagatgaaactcgctctattgcttaatgttatcgaccctaaa
attggtggggtgatgattatgggcgatcggggtacgggcaaatctaccaccatcagagcg
ttagcggatttgttacccgaaattagtgtagtggcaggagatccttttaattcagatccc
aatgatatggaaatgatgggggaagagttgagagaaaagattgaacaaaatcaacatatc
gataccgttcagaaaaaagtacccatgatcgatttacccttgggtgcgaccgaagatcgt
gtttgtggtactatcgacattgaaaaagccctttctgaaggggtgaaagcctttgaaccg
ggattactcgccaaggctaaccgtggtatcctttatgtggatgaggtaaacctcttggat
gaccacttggtagatgttctcctcgactccgccgctagtggttggaataccgtggaaagg
gaaggtatttccattcgtcaccctgcccgttttgtgttggtgggttctggaaaccccgaa
gaaggggaattaagacctcagttattagaccgttttgggatgcacgctgaaattcgtacg
gtcaaagatcctgatcttcgtgtgcaaattgtagaacaaagggcggagtttgatcaagac
cctcaaggtttcttggcgaaatatgaagatgatcaaagggctttgcaacaaaagttagtt
gatgcccaaaatcttttaccccaaatcaccatcgattatgaaatccgagtaaaagtctct
gagatttgttctgatctcgatgtggatggtttacggggtgatattgtgacaaatcgggcg
gcaaaggcgatcgcagcttttgaaggacgtaccgaggtaactgtggatgacattcgccga
gtaatgcccctctgtcttcgtcaccgtttacgtaaagatcccttagaatccattgattct
ggctacaaggtagagaaagccgtggatcgtgttttcgggttagaagtcgaatag

DBGET integrated database retrieval system