KEGG   Cyanobacterium stanieri: Cyast_1410Help
Entry
Cyast_1410        CDS       T02377                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
csn  Cyanobacterium stanieri
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyast_1410
Enzymes [BR:csn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cyast_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1552240..1552899
Genome map
AA seq 219 aa AA seqDB search
MTFTQSSIKKTVGEKNQLPSLVTEAQPQVSEAEMIEAVKTLLIGLGENPDREGLKDTPKR
VVKALKFLTSGYHQSLDELLNGAVFHENADEMVLVRDIDLFSSCEHHILPILGRAHVAYI
PNGKVIGLSKIARICEMYARRLQVQERLTAQIADALQGLLKPQGVAVVVEASHMCMVMRG
VQKPGSWTSTSALRGVFADDAKTRQEFMNLIQHRPRFNN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacattcactcaatcctcgataaagaaaacggtaggagaaaaaaatcaattaccttcc
cttgtcacagaagcccaaccccaagtaagtgaagcggaaatgattgaagcggtaaaaacg
ctcttaattggtttgggtgaaaatccagatcgagaaggattaaaagatacccccaaaaga
gtagtaaaggctcttaagtttctgacctcgggttatcatcaatccttggatgaattactc
aatggtgctgtgttccatgaaaatgccgatgaaatggtattagttcgggatattgattta
tttagttcttgtgaacatcatattttgcctattctaggacgtgcgcacgtagcttatatc
cctaacggtaaagtaatcggattgtcaaaaattgcgagaatttgcgaaatgtatgccaga
agattgcaggtacaagaacgtttaactgcccaaatcgccgatgctctgcaaggtttatta
aagccccaaggggtggctgtggtggtggaagccagtcacatgtgtatggtgatgcgtggg
gtacaaaaacccggttcttggacttctacgagtgctttacgaggtgtatttgctgatgat
gcaaaaacccgtcaagagtttatgaatttaattcaacaccgccccagatttaataattaa

DBGET integrated database retrieval system