KEGG   Cyanobacterium stanieri: Cyast_1410Help
Entry
Cyast_1410        CDS       T02377                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00790  Folate biosynthesis
csn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyast_1410
Enzymes [BR:csn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cyast_1410
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: AFZ47374
UniProt: K9YKI3
Position
1552240..1552899
Genome map
AA seq 219 aa AA seqDB search
MTFTQSSIKKTVGEKNQLPSLVTEAQPQVSEAEMIEAVKTLLIGLGENPDREGLKDTPKR
VVKALKFLTSGYHQSLDELLNGAVFHENADEMVLVRDIDLFSSCEHHILPILGRAHVAYI
PNGKVIGLSKIARICEMYARRLQVQERLTAQIADALQGLLKPQGVAVVVEASHMCMVMRG
VQKPGSWTSTSALRGVFADDAKTRQEFMNLIQHRPRFNN
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacattcactcaatcctcgataaagaaaacggtaggagaaaaaaatcaattaccttcc
cttgtcacagaagcccaaccccaagtaagtgaagcggaaatgattgaagcggtaaaaacg
ctcttaattggtttgggtgaaaatccagatcgagaaggattaaaagatacccccaaaaga
gtagtaaaggctcttaagtttctgacctcgggttatcatcaatccttggatgaattactc
aatggtgctgtgttccatgaaaatgccgatgaaatggtattagttcgggatattgattta
tttagttcttgtgaacatcatattttgcctattctaggacgtgcgcacgtagcttatatc
cctaacggtaaagtaatcggattgtcaaaaattgcgagaatttgcgaaatgtatgccaga
agattgcaggtacaagaacgtttaactgcccaaatcgccgatgctctgcaaggtttatta
aagccccaaggggtggctgtggtggtggaagccagtcacatgtgtatggtgatgcgtggg
gtacaaaaacccggttcttggacttctacgagtgctttacgaggtgtatttgctgatgat
gcaaaaacccgtcaagagtttatgaatttaattcaacaccgccccagatttaataattaa

DBGET integrated database retrieval system