KEGG   Cyanobacterium stanieri: Cyast_1558Help
Entry
Cyast_1558        CDS       T02377                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
csn  Cyanobacterium stanieri
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyast_1558
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyast_1558
   00052 Galactose metabolism
    Cyast_1558
   00500 Starch and sucrose metabolism
    Cyast_1558
   00520 Amino sugar and nucleotide sugar metabolism
    Cyast_1558
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Cyast_1558
   00524 Butirosin and neomycin biosynthesis
    Cyast_1558
Enzymes [BR:csn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Cyast_1558
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1725154..1726053)
Genome map
AA seq 299 aa AA seqDB search
MTEEKQVIGVDLGGTAIKFGRFLADGTCLESFSILTPKPATPEDVINAIAITVNKINQNN
NTVALGIGMPGATDAQGRIAKVAINLDGWHDVPLADELEEKTGLKTIICNDANCAGLGEA
WLGAGKNYQDLILLTLGTGVGGAVILDGKLFIGHKGAGGELGLVTFNPNGHPCNSGNKGS
FEQHASATAIYRDTGKKSSEWGKLAQKNDPTALQFWRDYGKILGTGLATYIYIFTPEAIL
IGGGVSASAEYFLPSAWEEVEKRVLPSSREGLKLLVAQLGNNAGIVGAAKLAWQLSEKI
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaaaaacaggtaattggggtggatttgggtggtacagccattaaatttgga
cgctttttggcagatggtacttgtttagagtcttttagtattcttacccccaaacctgca
acccctgaagatgtaataaatgcgatcgccattactgttaataaaatcaatcaaaataac
aatactgtcgctttaggaattgggatgccgggggcaacggatgcacagggtagaatcgcc
aaggttgccattaatttagatggatggcatgatgtacccctagccgatgaattggaagag
aaaacgggtttaaaaactattatttgtaacgatgccaattgtgcaggattaggagaagca
tggttaggggcaggaaaaaactatcaagatttaattttacttacccttggcacaggggta
gggggtgctgttatccttgatggtaaattatttattggacataaaggggcaggaggagaa
ttaggcttagtaacttttaaccccaacggacacccttgtaatagtggtaataaaggctcc
tttgaacaacacgcctcagctacggccatttatcgtgacacgggcaaaaaatcatcagaa
tggggaaagttggcacaaaaaaatgatcccactgccctacaattttggcgggattatggc
aaaatactgggtacaggattagcaacctatatttatatttttaccccagaagcgattttg
attggtgggggagtaagtgctagtgccgagtattttttaccttctgcatgggaagaggta
gaaaaaagagttttacctagttcaagggaaggtttgaaactattggttgcccaattgggt
aataatgcaggtattgtcggtgcggcgaagttggcttggcagttgagcgaaaaaatttag

DBGET integrated database retrieval system