KEGG   Cyanobacterium stanieri: Cyast_1752Help
Entry
Cyast_1752        CDS       T02377                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
csn  Cyanobacterium stanieri
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cyast_1752
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyast_1752
Enzymes [BR:csn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Cyast_1752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1937436..1938461)
Genome map
AA seq 341 aa AA seqDB search
MTTTTHWTKKHIISLEDFSKEEYDTVLNTAASFRDVLKSRTKKVPALQGQVVANMFFEPS
TRTRSSFELAAKRLSADILNFAPSSSSLTKGETILDTAKTYLAMGANIMVIRHSHSGVPL
NIAQEMDRLKTGVSIFNAGDGLHQHPSQGLLDLFTLTNLLDPKNPRTDLLKRKKIAIVGD
IIHSRVARSNINSLLTAGAHLHLAAPPTLLPNLFADTVKSEHKDRLFIHWHLEPALENAD
FVMTLRLQKERMADYLLPSLREYHQLFGITRDRLLLCNPDVKVLHPGPVNRGVELSSDLM
DDERLSLISDQVTSGVAVRMALLYLIGNLKQETNPQILPTV
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgactaccacaacccactggacaaaaaaacatatcatttccctcgaagactttagcaaa
gaagaatacgacaccgtattaaatactgctgctagttttcgggatgtgctaaagagtcgg
acgaaaaaagttcctgccctacaggggcaagtggtagctaatatgttttttgaaccctct
acccgcacccgtagcagttttgagttggcggccaaaagactatctgccgacattctgaat
ttcgcccctagttcatcatccctcaccaagggtgaaaccatccttgatacagcgaaaact
tacctcgccatgggtgccaatatcatggtaatccgtcatagtcattcgggagtgccttta
aatattgcccaggaaatggatcgactgaaaacgggggtaagtatttttaatgcgggggat
gggctacatcaacatccttctcaggggttactagatttgtttaccctcaccaatttatta
gatcccaaaaatcctcgcacggacttattaaaacgcaaaaaaatcgccattgtgggggat
ataattcattctcgggtggctcgttctaatattaacagtctgttaacagcaggtgcccat
ctacacctagcagcgccccctactcttttaccaaatttatttgcggatacggtaaaatct
gagcataaggatcgtttatttatccattggcatcttgaacctgctttggaaaatgctgat
tttgtcatgactctacggctacaaaaagagcgcatggcggattatttattacctagtttg
agggagtatcatcaattgtttgggattacgcgcgatcgccttttattatgtaatcctgac
gtaaaagtattacaccctggccctgtaaatagaggagtggaactaagttcggatttgatg
gacgatgaaagattgagcctaatttctgaccaagtcaccagtggggtagctgtgaggatg
gctttgttatacctgattggtaatttgaaacaagaaactaaccctcaaattttacccaca
gtttaa

DBGET integrated database retrieval system