KEGG   Cyanobacterium stanieri: Cyast_1832Help
Entry
Cyast_1832        CDS       T02377                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
csn  Cyanobacterium stanieri
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Cyast_1832
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Cyast_1832
Enzymes [BR:csn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Cyast_1832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2047255..2049657
Genome map
AA seq 800 aa AA seqDB search
MLKIELPNIPPQSWQCEIGKKWDNPYTVRYESNLDDGPNHGMPLGGFGAGCIGRAPSGDF
NLWHIDGGNHTFETLPACQFAVFEHSEGEDAQVYALSTNAPEDGSLSSWSWYPQGKGTYS
ALYPRSWFSYEGVFKSQLVCEQFSPVWAGSYQESSYPMAVFEWSIHNPTDKPITMSIMVS
WQNTVGWFTNAIKSPTVKVRDDGSPEYEYKPRWGNSTGNLNQWIQDGFRVGCLFDRIRLE
DEPTEGEGQWAIATTTNPTLEVFYHTRWNPKGDGSEIWDRFAMNGSLPDFQDETPAEPGE
QIAGAMAIRFTIRPGKTKKIPFILGWDFPVTEFAQGVNYFRRYTDFFGRNGRNVWSMIRT
GLKHHDMWQNKVKMWQEPILSRSNLPDWLKMALFNELYLLTQGGTLWTAATEDDPVGQFG
VLECIDYRWYESLDVRLYGSFGLLQLFPRLEKSVMEAFSRAIPTADDTPRIIGYNGASAI
RKAKGATPHDLGAPNEHPWIKSNYTSYQDCNLWKDLGSDFVLLVYRDYLYTGKNDQDFLW
ECWDSVVETLHYVKGFDLDNDGIPENSGAPDQTFDDWRLQGISAYCGGLWICALEAAIAI
GTILLDNPPVNPALEKENAQENIQGAIALFRQWLHQSRAIYHDTLWNGEYYNLDSKSGSD
VVMADQLCGQYYAQLLKLPDVVEKEYVTATLNKIYDACYLKFHNGTLGIANGVKPDGSPE
KENDTHPLEIWTGINYGIVAFMILNGMKEEGLKVAETVVNQVYSNGLQFRTPEAITAVNT
FRASHYLRAMAIWAIYQALS
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaatcgaactacccaatattcctcctcaatcttggcaatgtgaaatcggtaaa
aaatgggataatccctatactgtgcgctacgagagtaatttggatgatgggccaaaccat
gggatgcctttgggaggttttggggcaggttgtatcggtagggcgcctagtggagatttt
aatttgtggcacattgacgggggaaatcatacctttgagactcttcccgcttgtcagttt
gcggtatttgaacattccgagggggaagatgcccaagtatatgccctcagtaccaatgcg
ccggaagatggtagtttatcgagttggtcatggtatcctcaaggaaagggtacttattcg
gcactgtatccccgtagctggtttagttatgaaggggtgtttaaatcccagttggtgtgt
gaacaattttctcccgtctgggcaggaagttatcaggagtctagttatcccatggcagtg
tttgagtggagtattcataaccccacagacaagcccattaccatgagtattatggtatct
tggcaaaatacggtgggttggtttaccaatgccattaaatcccctacggtgaaggtgagg
gatgatggtagccctgaatatgagtataaaccccgttggggcaacagtacgggcaatctt
aatcaatggatacaggatggttttcgggtaggttgtttattcgatcgcatcaggttggaa
gatgaacccacggaaggagaagggcaatgggcgatcgcaactactaccaatcctacctta
gaagtattttatcacacccgttggaaccccaagggagacgggagcgaaatctgggataga
tttgccatgaatggctctctgcctgactttcaagacgaaacccccgccgaaccgggggaa
caaattgcgggggcaatggcaatcagatttactattcgccctggaaaaaccaaaaagatt
ccttttattttagggtgggatttccctgtaacggaatttgcccaaggagttaattatttt
cgtcgctatacggacttttttggcagaaatgggcgtaatgtgtggtcaatgattcgcacg
ggcttaaaacaccatgatatgtggcaaaataaggtaaaaatgtggcaagagccgattttg
agtcgttctaatttacccgactggttaaaaatggctctgtttaatgaattatacttgctt
acccaagggggtacattgtggacagctgccacggaggatgatcctgtgggtcaatttggg
gtgttagaatgtattgattaccgttggtatgaaagtttagatgtccgtttatacggctct
tttggacttctgcaacttttcccccgtctcgaaaagtccgttatggaagccttttcccgt
gccattcccacggcggatgataccccccgcattatcggttataacggtgcttcagccatt
cggaaggcaaagggggcaactccccacgatttgggcgcacccaatgaacatccttggata
aaaagcaactataccagttaccaagattgtaatttgtggaaggatttgggttcggatttt
gtgctgttggtatatcgggattatctttatacaggcaaaaatgatcaggatttcctctgg
gaatgttgggatagtgtggtggaaactttgcactatgtgaagggttttgaccttgataat
gatggtattcccgaaaattccggcgcccctgatcaaacttttgatgactggcgtttacag
ggtattagtgcctattgtggtggtttgtggatatgtgcgttggaagctgcgatcgccatt
ggtactatattattagataatccccccgtaaatcctgctttggaaaaggaaaacgctcag
gaaaatatccaaggtgcgatcgcccttttccgccaatggttacatcagtcaagggcaatt
taccatgataccctctggaatggggaatattacaacctagacagtaagagcggttcagat
gtagtaatggcagatcaactctgtggacaatattacgcccaattgttaaagttacccgat
gtggtggaaaaggaatatgtcaccgccaccctcaacaaaatttatgatgcttgttacctc
aaattccataacggcaccctcggtattgctaacggggttaaacccgatggaagcccagaa
aaagaaaatgatacccaccccctcgaaatttggacagggattaactatggcatcgtcgct
tttatgattcttaatggcatgaaggaggagggattaaaagtagcggaaaccgtggttaat
caggtgtatagcaatggtttacaattccgcacccccgaagcgattacggcggttaatact
ttccgcgctagtcattacctacgggcgatggcgatttgggctatttatcaggctttgagt
taa

DBGET integrated database retrieval system