KEGG   Cyanobacterium stanieri: Cyast_1937Help
Entry
Cyast_1937        CDS       T02377                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
csn  Cyanobacterium stanieri
Pathway
csn00790  Folate biosynthesis
csn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Cyast_1937
Enzymes [BR:csn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Cyast_1937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF HSCB_C
Motif
Other DBs
NCBI-ProteinID: AFZ47890
UniProt: K9YNA3
Position
complement(2154952..2155674)
Genome map
AA seq 240 aa AA seqDB search
MTVFSNGSDSLKENSLNSQSIVTEVFNNVGSRPDRNTHDGKEAKIQAIKEENKQKMMDAV
HQMLECLGEDPEREGLLKTPKRVAEAMQFLTQGYSQSLEKLVNGAIFDEGHNEMVLVRDI
DFFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAVQT
ILDPRGVAVVMEASHMCMSMRGVQKPGSWTVTSAMIGVFQDEDKTREEFLNLIQHQPQFR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgacagtattttccaacggttctgactctcttaaagaaaactctctaaactctcaatcc
atcgttaccgaagtattcaacaatgttggtagtcgtcccgatcgcaacacccatgacggc
aaagaagccaaaattcaggctatcaaagaagaaaacaaacaaaaaatgatggatgcagta
catcaaatgttagagtgtttaggagaagatccagaacgggaaggattgctcaaaacaccc
aaaagggtagcagaagccatgcagtttctcacccaaggttacagccaatctttagaaaag
ctcgttaatggggcgatttttgatgaaggtcataacgaaatggtcttagtcagagatatt
gatttcttcagcctctgtgaacatcacatgttacctttcatgggacgagctcatgttgct
tatatccccaatcaaaaagtagtcggattaagtaaacttgctcgtatcgtggaaatgtat
tcccgtcgtctgcaagtacaagaaagacttactcgtcagattgccgaagcggtccaaact
attctcgatccccgtggtgttgctgtggtaatggaagccagtcacatgtgtatgtccatg
cgtggggttcaaaaaccgggatcttggactgtcaccagtgccatgattggagtgttccaa
gacgaagacaaaacccgtgaggaatttttgaatctgattcaacatcaacctcaatttaga
taa

DBGET integrated database retrieval system