KEGG   Cyanobacterium stanieri: Cyast_2409Help
Entry
Cyast_2409        CDS       T02377                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
csn  Cyanobacterium stanieri
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:csn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2646031..2646822)
Genome map
AA seq 263 aa AA seqDB search
MLELYQFELSQFSEKVRLILDFKGLEYKKVEVTPGIGQLEVFKISGQRQVPVLKDGDTVI
SDSTEIAMYLDRKYPEKPLIPTDAVARGQCLLMEEWADESLGLKGRKTFLGALNQYQNFR
TSFLPSDTPDLLKNIVGSIPGDILGAIGNDMYKDAQRGLKQDLEALCLILQNQPYLVGDE
PTLADLTVAALSTIIKFPEVAYYDLPMDVTGKGIPGLADNSAYEPFFEWRDRLYAQYRQP
LDNSNRGNGSSNGDDKPTSIEIE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgttagaactatatcaatttgaattatcgcaattttccgaaaaagtacgtttaatatta
gatttcaaaggtttagaatataaaaaagttgaggtcacccctggtattggtcaactagag
gttttcaaaatttctggacaaagacaagtgcctgttttaaaagatggtgatacagtaatt
agtgattctacagaaatcgctatgtatttggatcgtaaatatcctgaaaaaccccttatt
cctactgatgcggtggccaggggtcaatgtttgctaatggaagaatgggcggatgagtct
ttgggtttgaagggtcgtaaaacttttttaggtgctcttaatcaatatcaaaatttccgc
acttcttttttacctagtgatactcctgatttattgaaaaatattgtgggttctatcccc
ggagatattcttggtgccattggtaatgatatgtataaagatgcccaaaggggtttaaaa
caagatttagaggctctttgtttgattttacagaatcaaccttatttggtgggtgatgaa
cctactttggctgatttaacagtggctgcccttagtaccattattaaatttcccgaggtt
gcttattatgatcttccgatggatgttactggtaaaggtattccgggtttggctgataat
agtgcttatgagcctttctttgaatggcgcgatcgcctttatgcccaatatcgtcaacct
ttagacaattctaaccgtggtaatggtagtagtaatggtgatgataaacctacttctatc
gaaattgaatag

DBGET integrated database retrieval system