KEGG   Cyanobacterium stanieri: Cyast_2483Help
Entry
Cyast_2483        CDS       T02377                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
csn  Cyanobacterium stanieri
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:csn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyast_2483
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyast_2483
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyast_2483
Enzymes [BR:csn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyast_2483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2725147..2726256
Genome map
AA seq 369 aa AA seqDB search
MVATKIPPNTLNTIPRSGWRGLIEEYRAYLPVTDTTPVVTLREGNTPLIPVPYISNLIGR
NVKVFVKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYATRAGLRA
FVIVPDGYVALGKLAQALIYGAEVLAIDGNFDDALTIVREIADNYPVTLVNSLNPYRLEG
QKTAAFEVVDTLGYAPDWVCIPVGNAGNITAYWMGFCQYQGEGRCDSLPRMMGFQAAGSA
PLIHGHQIMKPDTIATAIRIGNPANWDKALSVREASNGEFNAVTDAEILEAYKILGREEG
IFCEPASAASVAGVLKLKDQVPDNGTVVCVLTGNGLKDPDSAMSNSEGGIKGGIKADLQE
VAKVMGFEP
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtggtagcgacgaaaattcccccaaatacacttaacactatacctagaagcggatggaga
ggtttgatcgaagaatatcgagcctatttgcccgtaacagacaccaccccagttgtgacc
cttcgagaaggaaacactcccctaataccagttccctacatctccaacttgatcgggcgc
aacgtaaaagtattcgtaaagtatgatggtttaaaccctacaggttcatttaaagatagg
ggaatgaccatggctattaccaaagccaaagaggcaggggcaaaagcggttatctgtgcc
agtacaggaaacacctcagcggcggcggcagcctatgccactagggctggtttaagggct
tttgtcatcgtacctgatggttatgtggctttgggcaaattggctcaggctctcatatac
ggtgcggaagttcttgccattgatggtaattttgatgatgctttaaccatcgtaagggaa
attgctgataattatcccgttactttggtaaactccctcaatccttatcgtttggaagga
caaaaaacagcggcttttgaggtggtggataccctcggttatgcccctgattgggtatgt
attcctgtgggtaatgctgggaatattactgcctactggatgggtttttgtcagtatcaa
ggggagggtagatgtgatagtcttccccgtatgatgggttttcaggcggcaggttctgca
cctttgatccatggacatcagatcatgaaacctgatactattgctacggcgattcgtatt
ggtaacccggcaaactgggataaggctttgtcggtgcgtgaggcttctaatggggagttt
aatgcggtcactgatgcggaaattttggaagcctacaagattttgggcagagaagaaggc
attttctgtgaacctgccagtgcggcttctgtggcaggggtattgaagttaaaggatcaa
gtccctgataatggtacagtggtatgtgtattgactggtaatggtttgaaggatcctgat
agtgccatgagtaatagtgagggtggcatcaaaggaggcatcaaggctgatttacaggaa
gttgctaaggtgatgggttttgaaccttga

DBGET integrated database retrieval system