KEGG   Clostridium cf. saccharolyticum K10: CLS_10330Help
Entry
CLS_10330         CDS       T02614                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cso00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
999517..1001019
Genome map
AA seq 500 aa AA seqDB search
MKRESGILLPVSSLPSRYGIGCFSKEAYEFVDHLSEAGQSYWQILPLGPTSYGDSPYQSF
STFAGNPYFISLEDLIEEGVLTREECDSADFGKKQDSIDYAKLYRHRFPLLRKAYERSNI
SENREFLRFQAENRWWLRDYAIYMAVKARFEQKAWTEWAEDIRLRWDNAMDYYQRELYFD
IEFHEYLQFKFMEQWRRLKSYANSRGIRIVGDIPIYVAMDSADTWANPQLFQLDSENRPT
AVAGCPPDGFSATGQLWGNPLYNWEYHRNTGYQWWISRLAHCYQLYDVVRIDHFRGFDEY
FSIPADADTAITGHWEKGPGIDFFHRVRQALGEKEIIAEDLGYVTDSVRWLVKETGYPGM
KVLEFAFDSRDSGCAGDYLPHNYPENCVVYTGTHDNETISGWFHSIKKEERELARDYLCD
HYTPDKKLHLAFISLAMRSQARMCIIPLQDYMGLPNRCRINTPSTVGTNWKWRFLPEQMT
EELISLIGKTTLRFGRWNWR
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgagagagcggaattttgcttcctgtttccagtctgccgtccaggtacggcatt
ggatgcttttccaaggaagcctatgagtttgtggatcatctgagtgaggcaggccagtcc
tactggcagattctgcctctggggcctaccagctacggggactcaccctaccagtctttt
tctacctttgcaggcaatccctatttcatcagcctggaggatctgattgaggagggagtc
ctcaccagggaggagtgcgacagcgcagattttggaaaaaagcaggacagcattgattat
gcgaagctgtacagacaccgttttcctcttctcagaaaagcctatgagaggagcaatatc
agcgagaacagagagtttctccggttccaggcagaaaacaggtggtggctcagagactat
gccatctatatggcagtaaaagccagatttgagcagaaggcatggacagagtgggcggag
gatatccgcctgcgctgggacaatgccatggattactaccagagagagctctactttgat
attgagttccacgagtatctgcagtttaagtttatggagcagtggagaagactgaaaagc
tacgccaacagcaggggcatccgcattgtcggagacattcccatctacgttgccatggac
agcgcagacacctgggccaatccgcagctcttccagcttgacagcgaaaacaggcccaca
gcggtggcaggatgcccccctgacggattttcagccacaggacagctgtggggaaaccct
ctttataactgggaataccacagaaataccggttatcagtggtggatcagccgtctggct
cactgctatcagctctacgacgtggtgcgcatcgatcatttccggggatttgatgagtat
ttttccataccggcagacgcagacaccgcgatcacgggacactgggagaagggaccggga
atcgactttttccacagggtccgacaggctctgggcgaaaaggagattatcgccgaggat
ctgggctatgtgacggactctgtgcgctggctggtaaaggagacggggtatccgggaatg
aaggtgctggagtttgccttcgattccagggattccggctgcgccggcgattaccttccc
cacaattacccggaaaactgcgtggtctacacgggaactcacgacaatgagaccatctcc
ggctggttccactccatcaagaaggaggagagggagctggccagagattacctgtgcgat
cactacacgccggataaaaaactccacctggcctttatcagcctcgccatgcgaagccag
gccagaatgtgcatcattcctcttcaggattacatgggacttcccaaccgatgccggatc
aatacgccctccacagtggggacaaactggaaatggcgctttctgccggagcagatgaca
gaggagctgatttctctcattggaaagaccacgcttcggttcggcaggtggaactggaga
taa

DBGET integrated database retrieval system