KEGG   Clostridium cf. saccharolyticum K10: CLS_11130Help
Entry
CLS_11130         CDS       T02614                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cso00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CLS_11130
Enzymes [BR:cso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CLS_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1075838..1077337
Genome map
AA seq 499 aa AA seqDB search
MTTMLKRGAGILMPISSLPAPYGIGTFGKSAYEFADSLKRARQSYWQVLPLGPTSYGDSP
YQSFSAFAGNPYFIDLDTLLEEELLTKEEIDACYWLDSEEEVKYDAVYYYRFPLLKKAYE
RSRHGETEEYRAFCAKNSHWLDDYALYMALKGHFGNKEWMKWEEPIRLRKPEAVKRYEEL
LREEIGYWKFLQFKFYEQWEQLKNYVNGLGISIIGDIPIYVALDSADVWTHPELFQLDPD
TLTPLRVAGVPPDAFSDDGQLWGNPLYDWDKIEETGFAWWKDRMRASARLYDVVRIDHFI
GVVQYYSIPYGAEDGKTGEWKQGPGKKLTDAINEAAGDAKIIAEDLGIFCPAVKELLRET
GYPGMKIIEFAFSGDRFNEHLPHCYEPNSVVYGGTHDNETLVGYFKPEARQWWELQYIAD
YLGAAHHEEVPDKVFRAAYGSVASVAVFQMQDVLGLGNEARMNTPGTVGGNWKWRMKPGA
FGERETGYLAFLVDTFGRF
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatgctgaagcggggcgcgggcatccttatgcccatttccagccttccggct
ccatatggaatcggcacctttggaaagagcgcctatgaatttgcagacagtctgaaacgg
gcaagacagagctactggcaggtgctgcccctgggacccaccagctatggggacagcccg
tatcagtctttttctgcctttgcaggaaatccgtacttcattgatctggacacgcttctt
gaggaagagcttctgacgaaggaggagattgacgcctgctactggttggacagcgaggag
gaggtcaaatatgacgcggtctattattaccgctttccgctgctgaaaaaagcctatgag
agaagccgtcacggggagacagaggagtaccgggcattctgtgctaaaaacagccactgg
ctggacgattatgccctctacatggctctgaaaggccatttcggcaataaagagtggatg
aaatgggaggagcccatccggctcagaaaaccggaggctgtaaaaaggtatgaggaactt
ctgagggaggagattggctactggaagtttctgcagtttaagttttatgagcagtgggaa
cagctgaagaattatgtcaacgggctgggcatcagcataatcggagacatcccgatctat
gtggccctggacagcgcggatgtgtggacccatccagagctgttccagctggatccggat
acgctgacacccctcagagtggcgggcgttccgccggatgccttttctgatgacggccag
ctctgggggaacccgctctacgactgggataaaatcgaggaaaccggctttgcctggtgg
aaggacaggatgagggcttctgccagactctacgatgtggtgcggatcgatcatttcatc
ggtgtggtgcagtattattcgattccctacggggcagaggacggaaagacgggagagtgg
aagcagggaccaggaaagaagctgacggatgccatcaatgaggcggccggggacgcaaag
atcattgctgaagatctgggaatcttctgcccggcggtcaaggagcttctgcgggagact
ggatacccgggaatgaaaatcatcgagtttgccttcagcggcgaccggtttaacgagcat
ctgccccactgttatgagccaaactccgtggtttacggaggaactcatgacaatgagaca
ctggtgggctactttaagccggaggcaaggcagtggtgggagctgcagtatattgcggat
tatctgggagcagcacaccacgaggaggtgcctgacaaggtgttccgggcagcctatggc
tcggttgccagtgtggcagttttccagatgcaggatgtcctcgggctgggaaatgaggcc
agaatgaatacgccgggaacggttggaggaaactggaagtggaggatgaagccgggagcc
ttcggagagagggagacagggtatctggccttcctggtagacacattcggaaggttttaa

DBGET integrated database retrieval system