KEGG   Clostridium cf. saccharolyticum K10: CLS_24110Help
Entry
CLS_24110         CDS       T02614                                 

Definition
uroporphyrinogen-III synthase/uroporphyrinogen-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CLS_24110
Enzymes [BR:cso01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CLS_24110
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CLS_24110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2304028..2305656
Genome map
AA seq 542 aa AA seqDB search
MNMQEKGQDERQSERTVNRGKVWLVGAGPGDAGLLTLRGREVLEKAQSVVYDALVGDGIL
GWIPEGAEQIYVGKRGGSHTKSQEEINQILVEEAEKGRRVVRLKGGDPFVFGRGSEEALV
LREHGIPFEVVCGVTSAVAVPAACGIPVTHRGMAPSFHVITGHRKNGEPAHMDYSALARE
GGTLIFLMGVTSAETICRGLIEGGMDRHTPAALLEKGTTAGQRRVLSTLERLWEDGKSQN
IKPPAIIVVGEVCSLSESLQWMEEKPLFGAKILVTRPKRRSAGMAGRLREAGAEVVELPA
AEPRLLEDTSFLDRTLERLADFRWAVFTSPSGVELFFEYLRREKKDIRLLMGLKFAVIGA
GTAKALCRYGFYADYMPENFYAKELGRGLAETILHEMKEEEKRGENGRGGAGCGKPVKVL
LLRAQKASPALCEELARAEIPFEDAVLYRTEFPAPSMQAERVKILLEKKAFDYVTFTSES
TVKGFLELLSPTDEELCGFTAVCIGEMTEKAAREAGMRTVTSEVPSMDSMAECMISLQSV
RA
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcaggaaaaaggacaggacgaaaggcagtccgagagaacggtaaaccgtgga
aaggtatggctggtaggagccgggccaggcgacgcaggactcctgaccctcagaggcagg
gaggttctggaaaaggcccagtcggttgtctatgacgccctggtaggggacgggattctc
ggatggattcccgagggggcagaacagatttatgtgggaaagcggggaggctctcacacg
aaatctcaggaggagatcaaccaaattctggtggaggaagctgaaaaagggcgcagagtc
gtccggctgaaggggggagatccctttgtgttcggcagaggaagcgaggaggcgctggtt
ctgcgggaacacggaattccctttgaggtggtctgcggggtcacctccgccgttgccgtg
ccggccgcctgcggtatcccggtaacccaccgggggatggctccttcctttcacgtgata
acaggccacagaaaaaatggagagccggcccatatggattacagtgccctggcccgcgaa
gggggaactctcatttttcttatgggagtcacctcagcggagacgatctgccggggactc
atcgagggaggaatggacagacacacccctgccgctcttctggaaaaaggcaccacggcc
gggcagaggagggtgctctcgactctggaaaggctgtgggaggatggaaaaagccagaat
atcaagccgcctgccattattgtggtgggagaagtgtgcagcctctccgagagcctgcag
tggatggaggaaaaacctctgtttggcgcgaagatactggtgacgcgcccgaaaagacgt
tccgccgggatggccggcaggctgagggaggcaggggcggaggttgtggagcttccggcg
gcagagccgaggcttctggaggatacctctttccttgaccgtactctggaaagactggcg
gactttagatgggcagtttttacaagtcccagcggagtggaactgttttttgagtatctg
agaagagagaaaaaggacatccgcctcctgatggggcttaaatttgccgtaatcggagcg
ggaacggcaaaggccctctgcaggtacggattttatgcagactacatgccggagaacttt
tatgcgaaggaactgggcagagggcttgcagaaactatcctccatgagatgaaagaggag
gagaaaaggggagaaaatggcagaggaggggccggatgcggaaaacctgtgaaggttctt
ctgctgcgggcccagaaagcgtcgcctgctctctgtgaggagcttgccagggcagaaatt
ccatttgaggacgcggtgctttaccgcacggaatttccagccccgtctatgcaggcggag
agggtaaagatcctgctggagaaaaaagcctttgactacgttaccttcacaagtgagtcc
actgtgaagggctttcttgaacttctctcccccaccgatgaggagctctgcggctttact
gctgtctgcatcggagagatgactgagaaagcggcgagggaggccggaatgaggacagtg
acctcagaggtcccgtctatggacagcatggcggagtgcatgataagcctgcaaagcgtc
agggcatag

DBGET integrated database retrieval system