KEGG   Clostridium cf. saccharolyticum K10: CLS_32520Help
Entry
CLS_32520         CDS       T02614                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
cso  Clostridium cf. saccharolyticum K10
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:cso00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CLS_32520
  Lipid metabolism
   00561 Glycerolipid metabolism
    CLS_32520
   00600 Sphingolipid metabolism
    CLS_32520
Enzymes [BR:cso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CLS_32520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3106351..3107649
Genome map
AA seq 432 aa AA seqDB search
MCTQSLRDWEFALYDIDPVRLQESFEIISAMNRTKGGHGKVTAYLGVENRKEALRGARFV
INAIQVGLYDPCTIIDFEVPKKYGLRQTIGDTLGIGGIMRALRTIPVMDDFARDMQEVCP
DALFLNYTNPMAMLSGYMQRYTGIETVGLCHSVQVCSEFLLKELGMEDKLEGRRERIAGI
NHMSWLLELRDKDGNDLYPEIRRRAKLAVDAHLYGETQDAPDWVEKTRYDLVRLDYIRRF
GYYCTESSEHNSEYNMFYIKSKYPELIDRYHIPLDEYPRRCVEQIAGWEKERDELRAQKK
LEHERSREYASYIIESIVTGTPYKIGGNVLNIGGLIENLPSDACVEVPCLIDGMGVHPCR
AGRLPVQCAAMNMTNINVQLLTIEAAVTRKKEHIYQAAMLDPHTGSELDPDTIVKLVDDL
IETHGNWLPAYH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgtgtacccaatccctccgggactgggaattcgctctgtacgacatcgatcccgtccgc
ttgcaggagagctttgagatcatctccgccatgaacaggaccaagggcggacacgggaag
gtcaccgcctatctgggagttgaaaatcggaaggaagccctccggggggcccgattcgta
atcaacgccatccaagtgggcctctatgacccctgcaccatcatcgacttcgaggtaccc
aagaagtacggtctgcgccagaccatcggcgataccctggggattggcggtatcatgcgt
gccctgcgcaccattcccgtcatggacgacttcgccagggatatgcaggaagtctgcccg
gatgcccttttcctcaactacaccaaccctatggccatgctctccggctacatgcagcgg
tacacgggcatcgaaaccgtgggcctgtgccacagcgtccaggtgtgctcggaattcctg
ctgaaggaactgggcatggaggacaagctggaaggccgccgggagcgcattgccggaatc
aaccacatgagctggctgttggagctgcgggacaaagacggcaacgacctgtatccggaa
atccgccgccgggccaagctggctgtggacgcccacctctatggggaaactcaggacgcc
cccgactgggtggagaaaacccgctatgacctggtgcgtctggactacatccgccgtttt
ggctactactgcacggaatccagcgagcacaactccgaatacaatatgttctacatcaaa
tccaagtatccggagctcattgaccgctaccatatccctctggacgaatacccccgccgc
tgcgtagagcagattgccggctgggaaaaggaacgggacgagctgcgcgcccagaaaaag
ctggagcacgaacgttctcgggaatacgcttcctacattatagagtccattgtcacgggc
acaccctacaaaatcggaggaaacgtacttaacatcggaggcctcattgaaaacctgccc
tccgacgcctgtgtggaggtgccctgcctcattgacggcatgggggtacatccttgccgg
gcgggccgcctgccggtgcagtgtgccgccatgaacatgaccaacatcaatgtgcagctg
ctgaccatcgaagccgccgtgacccggaagaaagagcacatctatcaggccgccatgctg
gatccccataccggcagcgagctggacccggacaccattgtcaagctggtggacgacctc
attgagacccacgggaactggttacccgcgtatcattaa

DBGET integrated database retrieval system