KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c02860Help
Entry
Cspa_c02860       CDS       T02467                                 

Gene name
malQ1
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:csr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
290950..292488
Genome map
AA seq 512 aa AA seqDB search
MNRGSGIIMHIASLPGKYGIGTFGEEAYKFGDFLKDSGQKYWQILPLGPTSFGDSPYQSF
SAFAGNPYFIDFDILKKEGILNKEDYEVINFGKNPEKIDYAKIFIEKFKVLRKAYENFKI
KGNFNDIKKFEEKEAYWLEDYALYMALKNHFKLKNWQTWDEDIRLRKAESVTKYKKILSD
EVGYWKFLQFEFYKQWNELKAYVNRLGIQIIGDMPIYVAEDSADVWSNPEAFLLDKNTLK
PLKVAGCPPDIFSATGQLWGNPIYDWNYMEKTNYKWWVARIKQSLNLYDVLRIDHFKGFE
SYWSIPYGDLTAENGKWVKGPGIKIFNAIKEKLGEVNIIAEDLGTLTEETIKLRDDTGFP
GMKILTFAFDTDSTNPFLPHNYEENFIAYTGTHDNDTVRGWVETTAPKEQVKKAVQYLGL
NNEEGYNWGFIRGVWGSVARVAIAQMQDFLDLGNETRTNLPSTLGNNWCWRMKEDLINNN
LAKKIYSLTEIYGRCDQKKNKLAKDKNNLDTN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaggaagcggcatcattatgcatattgcttctttaccaggtaaatatggaata
ggaacttttggtgaggaagcatataaatttggggattttctaaaagactctggacagaag
tattggcagatacttccacttggccctactagttttggagattcaccatatcaatctttt
tcagcatttgctggaaatccatattttatagattttgatatattgaaaaaggaagggata
ttaaataaagaggattatgaagttataaactttggaaaaaatccagaaaaaatagattat
gcaaaaattttcatagaaaagtttaaagtattaagaaaagcatatgaaaattttaaaata
aagggcaattttaatgatataaagaaatttgaagaaaaagaagcttattggttagaggat
tatgctctgtatatggcattaaaaaatcatttcaaattgaaaaactggcagacttgggat
gaagatattagattaagaaaagctgaatcagtaactaaatataaaaaaatattaagtgat
gaggtaggatattggaagttcttacaatttgaattttataaacaatggaatgaattaaaa
gcatatgtaaataggcttggaattcagataattggagatatgcctatatatgtagcagaa
gatagtgctgatgtatggagcaatccagaagcatttttacttgataaaaacacattaaag
cctttaaaagttgcaggctgtccaccagatatattctcagctactggtcaattgtgggga
aatccgatatatgattggaactacatggagaaaactaattataagtggtgggttgctaga
ataaagcaaagtttaaatttatatgatgtgcttagaatagatcattttaaaggatttgaa
tcatattggtcaataccttatggcgatttaactgcggaaaatggtaagtgggttaaagga
ccaggtataaagatttttaatgcaatcaaagaaaaattaggagaagtgaatataattgca
gaagatttaggaaccttaactgaagaaacaattaaacttagagacgatacagggtttcca
ggcatgaaaatattgacatttgcttttgatacagatagtaccaatccatttttacctcat
aattatgaagaaaattttatagcttatacaggtactcatgataatgatacagttagaggg
tgggtggaaacaactgctccaaaggagcaagttaaaaaagcagtacagtatttggggtta
aataatgaggaaggatataattggggcttcattagaggggtatggggaagtgttgcacgt
gttgcaattgcgcaaatgcaagatttcttagacttgggaaatgaaactagaacaaattta
ccatccactcttggaaacaattggtgctggagaatgaaggaagatttaattaataataat
ttagctaaaaaaatctatagtttaactgaaatttatggaagatgcgatcagaagaaaaat
aaactggctaaggataaaaataatctagataccaattag

DBGET integrated database retrieval system