KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c06090Help
Entry
Cspa_c06090       CDS       T02467                                 

Gene name
tdk
Definition
thymidine kinase Tdk (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cspa_c06090 (tdk)
Enzymes [BR:csr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     Cspa_c06090 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
675570..676154
Genome map
AA seq 194 aa AA seqDB search
MSKLYFRYGAMNSGKSTHLMQVAHNYEERGMKIVIMKPKVDNKGGETLVSRLGVKRKVDF
LISEAEDIREIVHSYLNKNQNIDCILVDEVQFLKSQQIDELFEIAVKINIPIICYGLRTD
FKRNGFEGSTRLLLLAHSIEEMKTICACGKKAIFNGRKINNEFVFEGQQIAIDEQDNVQY
ESLCGECYYKFKEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattatattttagatatggtgcaatgaactctggtaagtcaactcatttgatg
caggttgcacataattatgaagaacgtggtatgaaaatagtaattatgaaacctaaagtt
gataataaaggtggagaaactcttgtatcaagacttggtgtaaaaagaaaagtggatttt
ttgatatctgaagctgaggatattagagaaatagtacatagttatttaaataaaaatcag
aatatagattgcatattagtagatgaagttcaatttttaaaaagccagcaaattgatgag
ctatttgaaattgctgtgaaaattaatattcctattatatgttatggacttaggacagat
tttaaaagaaacgggtttgaaggtagtacaaggctgctactgctcgcgcatagtattgaa
gaaatgaagacgatatgtgcgtgtggtaaaaaggcaatatttaatggaagaaaaataaat
aatgaatttgtctttgaaggtcaacagattgcaattgatgagcaagataatgtacaatat
gaatctttatgtggagaatgttattacaaatttaaagaaaaataa

DBGET integrated database retrieval system