KEGG   Clostridium saccharoperbutylacetonicum: Cspa_c09800Help
Entry
Cspa_c09800       CDS       T02467                                 

Gene name
malQ2
Definition
4-alpha-glucanotransferase MalQ (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
csr  Clostridium saccharoperbutylacetonicum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cspa_c09800 (malQ2)
Enzymes [BR:csr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Cspa_c09800 (malQ2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094475..1095962
Genome map
AA seq 495 aa AA seqDB search
MKRGSGIIMHIASLPGKYGIGTFGKEAYEFADFLKKAGQSYWQILPIGQTSYGDSPYQSF
SAFAGNPYFIDFDVLASKKLLRKSDYNKRKFGNNQNNISYETIFIEKMKVLRLAYKNFKK
YDDQNFNHFQEAEAFWLEDYSFFMALKTEFELKSFQTWENDIRLRVDKTLENYKQLLADE
IAFWKFIQYEFFNQWDELKKYVNKLGIKIIGDIPIYVAEDSADLWSNPKLFQLEEETLIP
KKVAGCPPDAFSETGQLWGNPIYNWDYLEETEYRWWISRIKHSLKLYDVIRIDHFRGFEA
YWSIPYGSETAQNGEWVKGPEMKLFDAIKSELGDVNIIAEDLGILTKATRKFKDKTGFPG
MKVLAFAFSGGSKNLYLPHNYEKNCVAYTGTHDNDTVRGWVETTGSKKEVQNAIKYLKLT
EEEGDNWGFIRGVWSSVADTSIALMQDFLNLGNETRINLPSTIGNNWVWRMEEGTLSDEL
AKKIRRMTKLYGRCE
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaggtagtggaataataatgcatattgcatcattaccaggaaaatacgggatt
gggacatttggaaaggaagcttatgagtttgcagattttttaaagaaagcaggacaaagt
tattggcagatacttccgattggtcaaacaagttatggtgattcaccgtatcaatcattt
tcagcatttgctggaaatccatattttattgattttgatgtattagctagtaaaaagttg
ttaaggaaaagtgactataataagcggaaatttggaaataatcaaaataatatttcttat
gaaacaatatttatagaaaaaatgaaagtattaagattagcatataaaaattttaaaaag
tatgatgatcagaattttaatcattttcaagaagcagaagctttttggttagaggattat
tctttttttatggctttgaaaactgaatttgagttgaagagttttcaaacttgggagaat
gatattaggttaagagttgataagactttggaaaattataaacagttgcttgcagatgaa
attgctttttggaaatttatacagtatgaattttttaatcaatgggatgaattgaaaaaa
tatgttaataaattgggaattaaaattataggtgatataccaatatatgtagcagaagat
agtgctgatttatggagtaatcctaagttatttcaattggaagaagagaccttgattcca
aagaaggttgcgggatgtcctcctgatgcattttcagaaacagggcagctttgggggaat
cccatttataattgggattatctcgaagagactgagtataggtggtggataagcaggatt
aaacatagcctaaagctatatgatgtaattagaatagatcattttagaggttttgaggct
tattggtctataccttatggttcagaaacagctcaaaatggagaatgggtaaagggacct
gagatgaagttgtttgatgcaataaaaagtgaacttggagatgtgaatataatagcagaa
gatttaggaatattaacaaaagcaactagaaaatttaaagataagactggctttccagga
atgaaagttttagcttttgctttttctggtggtagcaagaatttatatttaccacataac
tatgagaaaaattgtgtagcctatacaggaactcacgataatgatactgtacgaggatgg
gttgaaacaacaggaagtaagaaagaagtgcaaaatgcaattaaatatttaaaattaact
gaagaggagggggacaactggggatttattagaggtgtatggagcagtgttgcagatact
tcgattgcacttatgcaggattttttaaatcttggtaatgaaacgaggattaatttgcct
tctactataggaaataattgggtgtggagaatggaagaaggcacacttagtgatgaatta
gcaaaaaaaatacgtagaatgactaaactttatggaaggtgtgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system